KEGG   Enterobacter lignolyticus SCF1: Entcl_3498Help
Entry
Entcl_3498        CDS       T01342                                 

Definition
(GenBank) hydroxypyruvate isomerase
  KO
K01816  hydroxypyruvate isomerase [EC:5.3.1.22]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00630  Glyoxylate and dicarboxylate metabolism
esc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Entcl_3498
Enzymes [BR:esc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.22  hydroxypyruvate isomerase
     Entcl_3498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADO49743
UniProt: E3G875
Position
3740086..3740868
Genome map
AA seq 260 aa AA seqDB search
MAKFAANLSMLFTEYPFIERFAHASKAGFHGVEYLFPYDFPAEELAQTLRAHHLTQVLFN
LPAGDWNSGERGIACHPDRVAEFRDGVARAITYAQELRCSQVNCLAGKQPAGYSVEQCHE
TLVKNLRYAAEQLAEANIRLVLEAINTTDIPGFFVNNTQQVLNILHDVNHPNLQYQYDIY
HMQIMEGNLANTMKNNLDRIGHIQLADNPGRHEPGTGEINYPWLLGYIDKLGYQGWIGCE
YIPSATTADSLHWLNAMNND
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgcagcgaatttatccatgctatttaccgaatatccgttcattgaacgt
tttgctcatgccagcaaagccggttttcacggtgtggaatatcttttcccttatgacttt
cccgcagaagagctcgcgcagacgctccgcgcgcatcacctgacgcaggtgctgttcaat
cttccggccggggactggaacagcggcgaacggggtatcgcctgccatcccgatcgcgtt
gcggaattccgcgacggcgtcgccagggcgattacgtatgcgcaggagctgcgctgctcg
caggtaaactgcctggccgggaagcagcctgccggttattccgtagagcagtgccacgaa
acgctggtaaaaaatctgcgctacgccgcagagcagctggctgaagcgaatatcagactg
gtgctggaagcaattaataccaccgatatacccggtttttttgtcaataacacccagcag
gtactgaatattctgcacgatgttaaccatccaaacctgcaatatcagtacgatatttac
catatgcaaattatggaagggaatctggctaatacgatgaaaaacaacctcgatcggatt
ggtcacatccagcttgcggataatccaggacgccatgaacccggtaccggggaaattaat
tatccctggcttcttgggtatatcgataagctcggctatcagggctggattggttgcgaa
tatatcccttcagcaaccacggctgacagtcttcactggcttaatgccatgaataacgat
taa

DBGET integrated database retrieval system