KEGG   Enterobacter lignolyticus SCF1: Entcl_3499Help
Entry
Entcl_3499        CDS       T01342                                 

Definition
(GenBank) 2-hydroxy-3-oxopropionate reductase
  KO
K00042  2-hydroxy-3-oxopropionate reductase [EC:1.1.1.60]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00630  Glyoxylate and dicarboxylate metabolism
esc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Entcl_3499
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.60  2-hydroxy-3-oxopropionate reductase
     Entcl_3499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 2-Hacid_dh_C IlvN Rossmann-like ApbA
Motif
Other DBs
NCBI-ProteinID: ADO49744
UniProt: E3G876
Position
3740886..3741773
Genome map
AA seq 295 aa AA seqDB search
MNIGFIGTGIMGKPMAYNLQQAGHTLRFSEHFEPAPAELLNAHGIACKTPDEVARGSEII
ITMLPDTPHVEDVLFHPEHGVIHGLSAGKIVVDMSSISPVATKSFAQRVYATGAEYVDAP
VSGGEVGAKAGTLSIMAGGNESAFQRVKPLLDVMGKNITLVGNVGDGQTCKVANQIIVAL
NIEAVAEALLFASKSGADPARVREALMGGFAASRVLEVHGERMIKGTFDPGFRINLHQKD
LNLALENARLLQVALPNTATTQQLFSTCAAHGGSGWDHSALIRALEEMANFSIRQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatattggatttatcggcaccggtattatgggcaaacctatggcctataatttacag
caggctggccataccctgcgtttttcagagcatttcgaacccgcgccggcagagctcctc
aacgcccacggcattgcctgtaaaacacctgatgaggtcgcacgcggtagcgagataatt
atcaccatgctgcccgataccccgcacgttgaggatgtgctgtttcatcctgagcacggc
gttatacacggattgtcggcggggaaaattgtcgtcgacatgagctccatctcaccggtt
gcgactaaatcatttgcgcagcgcgtttatgcaacgggcgctgagtatgtcgatgccccg
gtgtcaggcggcgaagtcggcgccaaagcgggtaccttgtcgatcatggcgggcggtaat
gaaagcgcttttcaacgcgtaaaacccctgctggacgtgatgggaaaaaacatcacgctg
gtcggcaacgtcggcgatggccagacctgcaaagtcgccaatcagattattgtggcgctg
aatatcgaagccgttgccgaagccttactctttgccagcaaatccggcgccgatccggcg
cgggtacgcgaagcgctaatgggaggatttgccgcatcccgggtgctggaagttcacggc
gagcgcatgatcaaaggcacatttgatcctggttttcgtatcaacctgcaccagaaagat
ctcaatctggcgctggaaaacgcccgcctgcttcaggttgcgctgccaaacaccgccact
acgcagcagctgttcagcacctgcgccgcccacggcggcagcggctgggatcactcagcg
ctgatccgcgcgcttgaggaaatggctaacttctctattcgccagtaa

DBGET integrated database retrieval system