KEGG   Enterobacter lignolyticus SCF1: Entcl_3507Help
Entry
Entcl_3507        CDS       T01342                                 

Definition
(GenBank) dihydroxyacetone kinase, L subunit
  KO
K05879  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaL [EC:2.7.1.121]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00561  Glycerolipid metabolism
esc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Entcl_3507
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     Entcl_3507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak2
Motif
Other DBs
NCBI-ProteinID: ADO49751
UniProt: E3G883
Position
3749181..3749813
Genome map
AA seq 210 aa AA seqDB search
MKIHNKHIIAWLERCSVYMSEQQDFLTNLDRDIGDADHGLNMNRGFTAVEAILPEIERQH
IGNILKNTGMKLLSSVGGASGPLYGTLFIRASAAVGVRTELSFAEWLDCLQEGISAVVAR
GKAEQGDKTLCDVWVPVLHAAKVNLQSGMSESELLRTMEQDAVTAVNNTINMQAKKGRAS
YLGARSVGHQDPGATSSWLMIKAMQEGFTE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcataataaacatattattgcatggctggaacgctgctcagtgtacatgagc
gaacagcaggatttcttaaccaacctcgacagagatattggcgatgccgaccacggactg
aacatgaatcgcggtttcaccgctgtggaggcaatcctgccggagatagagcgtcagcat
atcggcaatatcctaaagaacaccggcatgaagctcctctccagcgtcggcggcgccagc
ggtccgctgtacggcacgctgtttattcgcgcctcggcggccgtcggggtgcgtaccgaa
ttaagctttgccgagtggctcgactgtctgcaggaagggatttccgccgtcgtcgcccgc
ggtaaagccgaacaaggcgacaaaaccctgtgtgacgtgtgggtcccggtgctccatgcg
gcgaaagtgaaccttcagtctggaatgtcggaaagcgagctacttcgcaccatggagcag
gatgccgtcacggcggtgaacaacaccatcaatatgcaggccaaaaaagggcgcgccagc
tacctcggcgcgcgcagcgttgggcaccaggatcccggagcaacttcctcctggttgatg
attaaagccatgcaggaaggattcacggaataa

DBGET integrated database retrieval system