KEGG   Enterobacter lignolyticus SCF1: Entcl_3508Help
Entry
Entcl_3508        CDS       T01342                                 

Definition
(GenBank) phosphoenolpyruvate-protein phosphotransferase
  KO
K02768  PTS system, fructose-specific IIA component [EC:2.7.1.202]
K08483  phosphotransferase system, enzyme I, PtsI [EC:2.7.3.9]
K11183  phosphocarrier protein FPr
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00051  Fructose and mannose metabolism
esc01100  Metabolic pathways
esc01120  Microbial metabolism in diverse environments
esc02060  Phosphotransferase system (PTS)
Module
esc_M00273  PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Entcl_3508
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Entcl_3508
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:esc02000]
    Entcl_3508
Enzymes [BR:esc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     Entcl_3508
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     Entcl_3508
Transporters [BR:esc02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    Entcl_3508
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    Entcl_3508
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    Entcl_3508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C EIIA-man PEP-utilizers PTS-HPr PEP-utilisers_N HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADO49752
UniProt: E3G884
Position
3749816..3752188
Genome map
AA seq 790 aa AA seqDB search
MTAIVIVSHSLRLAQGIEELALQMSGGKVPLAVAAGIDDPQNPIGTDAIAILSAIESVWS
PAGVLVFMDMGSALLSTEMALELLSEEQRAAVHLMSAPVVEGVLSAIVCAAAELPISAII
AEAASALDAKRQHLHPNEAAATDITPEPGQSIAEQAHTLRWTVRNFHGIHARPAAKIVAT
AARCDAEITVINGDKRASARSLNGLAMLGIRCGDEILFQISGHDASQAIQLITSLAQSHF
GESHALEPVANEPQPVQRITAEGAVSGLPVNEGIAIGCVKWFSCELPEFPLRTPASPAEE
MAKIDSAIGAVLHALEQKALGPEGEIFAAHQAMLDDPEIRLQVLQELGKGDQAETAWMNV
MQEVASRYRHASSPYFREREADVHDLARQVLLALCGVSEGTFATHEPCILLADDLLPSQV
ANLDKRHILGICLRNGGATSHSAILARAMGIPAVVKAAIASTQIPDGAEVILDGGKGQLW
FDPDDATRLSLIQRHDEWRQSKASALASAAQPAITRHGQRINVLANIGGPEDVDAALAQG
AEGVGLFRTEFLFHDAAELPGEDEQFRVYCDIARAFGDKPVTIRTLDIGGDKPLAALPQA
KEDNPFLGLRGIRLCLASPQIFIPQLRALLRAGALHPNLQIMLPMISTQDEVAAVQALTQ
QQAQLLNIPQERLPALGIMIEVPAAVMIADALAQQVDFFSIGTNDLTQYIMAADRGNSAV
AELVDYRNEAVVSAIARVCEAGRTYGIPVSMCGEMAGDVTQTALLLRLGIDKLSASAARL
PALKATIREL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccattgtcattgtttctcacagcctgcgcctggcgcaggggatcgaagagctg
gccctgcaaatgtccggaggaaaggttccactggccgttgccgccggcatcgacgatccg
caaaacccgatcggcaccgacgctatcgctatcctgtcggctattgaatccgtctggtcg
ccggcgggcgtgctggtattcatggatatgggcagcgcgctgctcagcaccgaaatggcg
ctggagctgctatcggaagaacagagagccgccgtacatctgatgtcggctcctgtagtg
gaaggggtactgtccgccattgtctgtgcagcggcagaacttccaatatcagccattatc
gccgaagccgccagcgcccttgacgcaaagcgccagcatcttcaccccaacgaggctgcg
gctactgacatcacgccagagccgggccagagcatcgcagagcaagcgcacacgctgcgc
tggacggtgcgtaattttcacggtattcacgcgcgcccggcggcaaaaattgtcgccaca
gcggcccgctgtgatgcagagattaccgtgatcaacggcgataagcgcgccagcgcccgg
agcctcaacgggctggccatgctcggtattcgctgcggcgacgagatcctctttcagata
tcaggtcatgacgccagtcaggcaattcagctgataacatcgcttgcgcagagccatttt
ggcgaatctcatgcgctggagcctgttgcgaacgagccgcagccggtccagcgcatcacc
gcagaaggcgcggtatccggcctgccggttaacgaagggatcgccatcggctgcgtgaaa
tggttctcctgcgaactacccgagtttccgctgcgtaccccggcgagtcctgcggaagaa
atggcgaaaatagactcggcgattggcgccgttctccacgcgctggagcaaaaagcgctc
ggcccggaaggagaaatctttgccgcgcaccaggcgatgttagacgaccctgagattcgc
ctgcaggtattgcaggagctgggaaaaggtgaccaggccgaaaccgcgtggatgaacgtg
atgcaggaggtcgcgagccgctatcgtcatgccagcagcccgtacttccgcgaacgcgaa
gccgacgtacacgatcttgcccgtcaggttcttctggcgctttgcggcgtcagcgagggg
acgtttgccacccatgagccctgcatattgctggcggacgatctgctgccctctcaggtc
gctaatctggataagcgccatatcctgggtatttgcctgcgcaacggcggcgccacatcg
catagcgcgatcctcgccagagcgatgggtatcccggcggtggtcaaagcggcgatcgcc
agcacgcagatccctgatggcgcggaagtgatcctcgacggcggcaaaggacagctctgg
tttgatccggatgacgcaacgcgcctgagcctgatccagcgtcacgatgaatggcggcaa
tccaaagctagcgcgcttgccagcgcagcgcagccggccatcacccggcacggtcagcga
attaatgtactggcgaatattggcggcccggaggatgtggatgccgctctggcgcaggga
gcggagggggttgggctatttcgtaccgagtttttattccacgatgcggccgaactcccc
ggcgaggatgagcagttccgggtttactgcgatatcgcccgggcgtttggcgataagccg
gtcaccatccggacgctggatatcggtggagacaagcctttagccgcccttccgcaggcc
aaagaggacaatccgtttctcgggctgcgcggcattcgcctttgcctggcctcgccgcag
atttttataccacagctacgcgcgctgctgcgggctggagcgttgcatcccaatctgcaa
attatgctgccgatgatatcaacgcaggatgaggtcgctgcggtacaggcgctgacgcaa
cagcaggcgcaattgttgaatattcctcaggaacgtctccctgcgctcggcatcatgata
gaagtccctgccgccgtgatgattgcggatgcgctggcgcagcaggtcgattttttctcg
ataggcaccaacgatctgacgcaatacatcatggcggccgatcgcggcaacagcgcggtt
gccgagctggtcgattatcgcaacgaggcggtcgtcagcgctattgcgcgcgtttgcgaa
gccggacgcacctatggcataccggtcagtatgtgcggcgaaatggcaggcgatgtcacg
cagaccgcgcttctgctgcgtctgggaattgataagcttagcgccagcgcggcgcggctt
ccggcgttaaaagccacgatcagagagctgtaa

DBGET integrated database retrieval system