KEGG   Enterobacter lignolyticus SCF1: Entcl_3509Help
Entry
Entcl_3509        CDS       T01342                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K13566  omega-amidase [EC:3.5.1.3]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00250  Alanine, aspartate and glutamate metabolism
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Entcl_3509
Enzymes [BR:esc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.3  omega-amidase
     Entcl_3509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ADO49753
UniProt: E3G885
Position
3752282..3753052
Genome map
AA seq 256 aa AA seqDB search
MPGLKITLLQQPLVWMDGPANLRHFDRQLEGIQGRDIIVLPEMFTTGFAMEAATQSLPEN
DVVMWMQSKARQTNALIAGSAALQVERGPVNRFLLVEPDGRVHRYDKRHLFRMADEHHHY
EAGNERVIFEWRGWRILPLVCYDLRFPVWSRNRGDYDLALYVANWPAPRSLHWQALLVAR
AIENLAYVAGCNRVGTDGNGHHYRGDSRVVSPQGEILATADPHQVTRIDAELSLTALKEY
REKFPAWQDADPFTLD
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcctggtttaaaaataacactgttgcaacagcctttggtgtggatggacggccctgcc
aacctgcgccatttcgatcgccagctggaagggatacagggacgggatatcatcgtctta
ccggaaatgtttactaccggtttcgcgatggaagcggcgacgcaatcgctccccgaaaac
gacgtagtcatgtggatgcagagcaaagcccggcagaccaatgcgcttatcgccgggagc
gccgccctgcaggtggagcgcggcccggtcaaccgctttttactggtagagcctgatggc
cgggttcatcgttacgacaagcgccatctgttccgcatggccgatgagcatcatcattac
gaagcgggcaatgaacgcgtgatcttcgaatggcgaggctggcgaatcctgccgctggtg
tgttacgacctgcgtttcccggtatggtcgcgtaaccgcggcgattacgatctggcgctg
tatgtggcgaactggccggcgccacgctcgctgcactggcaggcgctgctggtcgccagg
gccattgagaacctcgcctatgtcgcgggctgcaaccgcgtcggcaccgacggcaacggc
caccactatcgcggcgacagccgcgttgtcagcccgcagggagaaattcttgccaccgcg
gacccgcaccaggtgacgcggattgatgcagaactgtcgctgaccgcgttaaaggagtac
cgcgagaaattcccggcgtggcaggatgcggacccgttcactctggattag

DBGET integrated database retrieval system