KEGG   Enterobacter lignolyticus SCF1: Entcl_3515Help
Entry
Entcl_3515        CDS       T01342                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
esc  Enterobacter lignolyticus SCF1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DUF2206
Motif
Other DBs
NCBI-ProteinID: ADO49759
UniProt: E3G891
Position
complement(3758636..3760285)
Genome map
AA seq 549 aa AA seqDB search
MVQINENIATPPVSSLSRFFAKSRIIAKPGFNRWLVPPAALAVHLCIGMAYGFSVYWLPM
SHLIGGSAPLQCPPEISFWQQLFTRQCDWKISMLGWTYTLFFVFLGCSAALWGSWLEKVG
PRLVSFVATLCWCGGLLLSAIAIYFHQLWLLWLGAGVIGGIGLGLGYISPVSTLLRWFPD
KRGMAAGMAIMGFGGGALVGAPLANWLMNFFADGQGNGVWQSILALSAIYALFMLCGTFG
YRLPPMGWHPSGEKAQKVINSNPGIQVHVSVAWRTPQFWLLWLVLWLNVTAGIGILGMAS
PMLQEIFAGKLLSLDLSWQALNGEQLKRIATVAAGFTGLLSLFNILGRFFWASVSDMCGR
KVTFALIFFLGALLYGTLPLINHGGYVALFVCALCVIISMYGGGFATIPAYLADVFGSQM
VGAIHGRLLTAWSAAGISGPVLVNYLREYQLAQGVDPARIYDITLLVLTGLLIIGFICNQ
LVRPIPPKYAMTAEQQQQAKGLYTINKDALLTWHPKPATPLLTLSWIAVGVPLLWGMGTT
LQQAVKFFM
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagattaatgaaaatatcgcgactccgcccgtttcatcgttgagtcgttttttt
gctaagtcccgcattattgccaaacctggatttaaccgctggttggtccctcctgccgcg
ctggcggtgcatttgtgtatcggcatggcctatggcttttccgtttactggctgccgatg
tcgcatctgattggcggcagcgcgccgctgcagtgtccgcctgagatctcgttctggcag
cagctctttacccgtcagtgcgactggaaaatctccatgctcggctggacctacacgctg
tttttcgtttttctcggctgttccgcggcgctgtgggggagctggctggagaaagttggc
ccgcggctggtaagttttgtcgccactctgtgctggtgcggcggcctgctgctgtcggcc
atcgctatctatttccatcagctgtggctgctgtggttgggggctggcgtgattggcggt
attggtcttgggctcggctatatctcaccggtttcaacactgctgcgctggtttcccgat
aagcgcgggatggccgcggggatggcgattatgggtttcggtggcggggcgctggtgggc
gcgccgctcgcgaactggttaatgaacttttttgccgatggtcaggggaacggcgtctgg
caaagcattctggcactatcggcaatttacgcgttgtttatgctttgcggtaccttcgga
taccgtctgccgccgatgggctggcacccgagcggcgagaaggcgcaaaaggtcatcaac
agcaacccaggcattcaggttcacgttagcgtggcctggcggacccctcagttctggcta
ctgtggctggtactatggctgaatgtcaccgccgggattggtattctcggtatggcctcg
ccgatgttgcaggagatttttgccggcaagctgttatcgctggatctgagctggcaggcg
ctaaatggtgaacagcttaagcgtatcgccaccgtggccgccggttttaccggcttgctc
agcctgtttaatattctggggcgttttttctgggcctcggtttcggatatgtgcggcagg
aaagtgacttttgcgctgatctttttcctcggcgccttactttatggcacgctgccgctg
attaaccatggcggctacgtagcactctttgtctgcgcgctgtgcgtgatcatctccatg
tacggcggcggtttcgctactatcccggcttatcttgctgatgtattcggttcgcaaatg
gttggcgcgatccacggtcgcttgctgaccgcatggtcggcggccggaattagcggcccg
gtactggtcaactacttgcgtgagtatcagctggcgcagggcgtggacccggcgcggatc
tacgatattacgctgctggtgctgaccggactgttaattatcggttttatctgcaatcaa
ctggtacggccaattccgccaaaatacgcgatgaccgccgagcaacagcagcaggctaaa
gggctgtataccatcaataaagatgctctgcttacctggcatcctaagcctgcaacaccg
ctactgacgctgagctggattgctgtcggtgtgccgctgctgtgggggatggggactacg
ctgcagcaggcggtgaagttctttatgtag

DBGET integrated database retrieval system