KEGG   Enterobacter lignolyticus SCF1: Entcl_3517Help
Entry
Entcl_3517        CDS       T01342                                 

Definition
(GenBank) (2Fe-2S)-binding domain-containing protein
  KO
K03518  aerobic carbon-monoxide dehydrogenase small subunit [EC:1.2.5.3]
Organism
esc  Enterobacter lignolyticus SCF1
Brite
KEGG Orthology (KO) [BR:esc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Entcl_3517
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     Entcl_3517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_2 Fer2_3 Fer2
Motif
Other DBs
NCBI-ProteinID: ADO49761
UniProt: E3G893
Position
complement(3762490..3762948)
Genome map
AA seq 152 aa AA seqDB search
MSIIKVKVNGKLVEAKVEGNMRLLDLVRDTLRLTATKEGCSIGECGACTVLMDGNAVCSC
LVLAAQCDDAEIVTLEGLNDNPITQKLQDAFIEKGGVQCGFCTPGVLVSATELLTKDPNP
TEAQIKDVLEGNMCRCTGYQPIIDSIQHAIKS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagcataattaaagtgaaggtgaacggcaagctggtggaagcgaaggtcgaaggcaat
atgcggttgttggatctggtgcgcgatacgttgcgacttaccgccaccaaagagggatgt
tcgataggtgaatgcggcgcctgtacggtgctgatggacggtaacgcggtgtgttcctgt
ctggtgctggccgcgcagtgtgatgatgcggagattgtgactctcgaagggttaaatgat
aatccgattacccaaaaattacaggacgcatttatcgagaagggcggcgtgcagtgcggg
ttttgtaccccgggagtactcgttagcgccactgagctactaaccaaagatccaaaccca
accgaagcgcagataaaggatgtgttagagggcaatatgtgccgttgcacaggctaccaa
ccgattatcgactccattcaacacgcgattaaatcgtaa

DBGET integrated database retrieval system