KEGG   Enterobacter lignolyticus SCF1: Entcl_3519Help
Entry
Entcl_3519        CDS       T01342                                 

Definition
(GenBank) Lysine decarboxylase
  KO
K01582  lysine decarboxylase [EC:4.1.1.18]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00310  Lysine degradation
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Entcl_3519
Enzymes [BR:esc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.18  lysine decarboxylase
     Entcl_3519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OKR_DC_1 OKR_DC_1_C OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ADO49763
UniProt: E3G895
Position
complement(3766654..3768798)
Genome map
AA seq 714 aa AA seqDB search
MNVIAIMNHTGVYFKEEPIRELHRALERLDFGIVYPNDREDLLKLIENNAQLCGVIFDWD
TYNFELCEEISEMNEYMPLYAFANTYSTLDVSLNDLHMQVRFFEYALGAADDIAAKIKQN
TDEYIDTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPVGSLFYDFFGANTMKSDI
SISVSELGSLLDHSGPHKEAEEYIARVFNAERSYMVTNGTSTANKIVGMYSAPAGSTVLI
DRNCHKSLTHLMMMSDITPIYFRPTRNAYGILGGIPQSEFQHATIARRVKETPNATWPVH
AVITNSTYDGLLYNTDFIKKNLDVKSIHFDSAWVPYTNFSPIYEGKCGMSGGRVEGKVIY
ETQSTHKLLAAFSQASMIHVKGDVNEETFNEAFMMHTTTSPHYGIVASTETAAAMMKGNA
GKRMIRGSIERAIKFRKEIKRLKGESDGWFFDVWQPEHIDKPECWPLRSDSAWHGFKNID
NEHMSLDPIKVTLLTPGMKKDGTMDDFGIPASIVAKYLDEHGIIVEKTGPYNLLFLFSIG
IDKTKALSLLRALTDFKRAFDLNLCVKNILPSLYRKAPEFYENMRIQDLAQNIHKLVEHH
NLPDLMFRAFEVLPAMVMTPYTAFQKVLHGEVEDVCLEEMVGRVNANMILPYPPGVPLVM
PGEMITEESRPVLEFLQMLCEIGAHYPGFETDIHGAYRQEDGHYVVSVLKENNK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttattgcaatcatgaatcacacgggtgtctactttaaagaagaacctatccgt
gaactgcaccgtgcccttgagcgcctggatttcggcattgtttacccgaacgaccgcgaa
gatctgctgaaacttatcgaaaacaatgcgcagctgtgtggtgtgattttcgactgggac
acatacaatttcgagctgtgcgaagaaatcagcgaaatgaacgaatacatgccgctgtat
gcgtttgctaacacttattccactctggacgttagcctgaacgatctgcacatgcaggtt
cgtttcttcgaatatgcgctgggcgcagcagatgatatcgcggctaaaatcaaacagaac
accgacgaatatatcgacaccattctgccgccgctgaccaaggcgctgttcaaatacgtc
cgcgaaggcaaatacaccttctgcacccctggccacatgggcggtaccgcgttccagaaa
agcccggtaggtagcctgttctatgatttcttcggtgctaacaccatgaaatccgatatc
tccatctccgtgtccgagctgggctccctgctcgaccacagcggtccgcataaagaagcc
gaagagtacatcgcccgcgtcttcaacgctgaacgcagctacatggtgaccaacggtacg
tctaccgcgaacaaaatcgtcggtatgtattccgccccggcgggcagcaccgttcttatc
gaccgtaactgccacaaatcgctgacccatctgatgatgatgagcgacattacgccgatt
tacttccgtccgacccgtaacgcctacggcatcctcggcggtattccgcagagcgaattc
cagcacgcgaccatcgccaggcgcgtcaaagagacgccgaatgcaacctggccggtacac
gcggttatcaccaactccacctatgacggcctgctgtacaacactgatttcatcaagaaa
aatctggatgtgaaatccatccactttgactccgcctgggtgccttacaccaacttctcg
ccgatttacgaaggtaaatgcggtatgagcggcggccgtgtggaagggaaagtgatttat
gaaacccagtccacccataaactgctggcggcgttctcgcaggcttccatgatccacgtt
aaaggcgacgtcaacgaagaaacctttaacgaagcgttcatgatgcacaccaccacttct
ccgcactacggtatcgtggcgtccaccgaaaccgcagcggcgatgatgaagggtaatgcg
ggtaagcgcatgatcagaggctctatcgagcgcgctatcaagttccgtaaagagatcaaa
cgcctgaaaggcgaatccgacggctggttcttcgacgtatggcagccggaacatatcgat
aagccggaatgctggccgctgcgttctgacagcgcatggcacggtttcaaaaacatcgat
aacgagcacatgtcccttgacccaatcaaagtcactcttctgactccggggatgaagaaa
gacggtaccatggatgatttcggcatcccggcaagtatcgttgcgaaataccttgatgaa
cacggcatcattgttgagaaaaccggtccgtacaacctgctgttcctgttcagcatcggt
atcgacaaaaccaaagcgctgagcctgctgcgcgcgctgaccgacttcaaacgcgcgttc
gacctgaacctgtgcgtgaaaaacattctaccgtcgctgtaccgtaaagctcctgagttc
tatgaaaatatgcgcattcaggacctggcgcagaacatccacaaactggttgagcatcac
aacctgccggacctgatgttccgcgccttcgaagtgctgccggccatggtcatgaccccg
tacaccgcgttccagaaagtgttgcacggtgaagtggaagacgtttgcctcgaagagatg
gttggccgcgtcaacgccaacatgatcctgccgtatcctccgggagtgccgctggtgatg
ccgggcgaaatgatcaccgaagaaagccgtccggtactggagttcctgcagatgctgtgc
gaaatcggcgcccactacccgggcttcgaaaccgatatccacggcgcatatcgccaggaa
gacggccattacgtcgtcagtgtgctaaaagaaaacaacaagtaa

DBGET integrated database retrieval system