KEGG   Enterobacter lignolyticus SCF1: Entcl_3527Help
Entry
Entcl_3527        CDS       T01342                                 

Definition
(GenBank) Methyltransferase type 11
Organism
esc  Enterobacter lignolyticus SCF1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ADO49769
UniProt: E3G8A1
Position
complement(3775983..3776705)
Genome map
AA seq 240 aa AA seqDB search
MKPARISLTVTAPGHWAEMPWGEYYREALEQQLKPWLTKLYGFHLLKIGNLSAEINTEAC
AISHQVNVSLGGEPRQVIADPLYLPFADKSVDACLLAHTLPWCQDPHRLLREADRVLIDD
GWLIMTGFNPVSLMGLRKLAPVLRGSMPYNSRMFTMMRQLDWLSLLNFEVLHHGRFQVLP
WNRQGGRLLSTHLPALGCLQLIVARKRTIPLTLNPMKQSKSRTQLRPAVGATRQYRKPRL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggcaaggatatccctgaccgtcaccgcgccaggccattgggcagagatgccc
tggggcgaatattatcgtgaagcgctggaacaacagcttaagccctggctgacaaaactc
tacggatttcatctgctgaagattggcaatttgagcgctgaaatcaacaccgaggcctgc
gcgatttcccatcaggtaaatgtgtcgctcggcggcgaacccaggcaagttatcgccgat
ccgctgtatttgccttttgcggataagtcggtcgatgcctgtctgttggcccacacgctg
ccctggtgccaggatccgcaccgtcttctgcgcgaggcggatcgcgtactgatcgatgac
ggctggcttatcatgaccggttttaacccggtgagcctgatggggctgcgaaaactggcg
ccggtgctgcgcggcagtatgccgtataacagccggatgttcaccatgatgcgccagctc
gactggctgtcattgctgaattttgaggtgctgcaccatggccgcttccaggtgctgccc
tggaaccggcagggagggaggctgctcagcacccatctgccggcgctcgggtgtctgcag
cttatcgtggcgcgcaagcgaacgataccgctgacgcttaacccgatgaaacagagtaaa
tcccgaacgcagctgcgcccggcggtaggcgcgacgcggcagtatcgtaagccgcggctc
tag

DBGET integrated database retrieval system