KEGG   Enterobacter lignolyticus SCF1: Entcl_3528Help
Entry
Entcl_3528        CDS       T01342                                 

Definition
(GenBank) hydroxyacylglutathione hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Entcl_3528
Enzymes [BR:esc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     Entcl_3528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2 Lactamase_B_3
Motif
Other DBs
NCBI-ProteinID: ADO49770
UniProt: E3G8A2
Position
3776744..3777499
Genome map
AA seq 251 aa AA seqDB search
MNLNSIPAFQDNYIWVLSDNKQHCLIVDPGEAAPVLRAIEENHWQPEAILLTHHHHDHVG
GVKEVLQKYPGIVVYGPQETQDKGTTVIVNEGDTLHVLGCEFSVISTPGHTTGHVCYFSN
PYLFCGDTLFSGGCGRLFEGTAAQMYQSLQKINALPDHTLICCAHEYTLANMKFALSIMP
DDLAINDYFREVKELRAKNQKTLPTILKNERKINLFLRTNDIDFIEEISRETNLQQPEER
FAWLRSKKDNF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttaacagtattcccgccttccaggacaactacatctgggttctgagtgataac
aagcaacattgcctgattgtcgacccgggcgaagcggcgccggtgcttcgcgccattgaa
gaaaaccactggcagcccgaggccattctgctcacgcaccatcatcacgatcacgttggc
ggcgtgaaagaagtcctgcaaaagtatccgggtattgtggtgtatggtccgcaggagaca
caagataagggtacgacggtcatcgttaacgaaggggatacgcttcacgttttgggatgc
gaattttccgtaatttcgacccctgggcacaccaccgggcacgtgtgttactttagcaat
ccttatcttttctgcggcgatacgctgttctcgggcggctgtggccggctgttcgaaggg
actgctgcgcagatgtaccaatctttgcaaaagattaacgcacttcccgatcatacgtta
atttgttgtgcccatgagtatacgttagcaaacatgaagtttgccctgagtattatgcct
gatgatttagcgataaatgattatttcagagaagttaaagagttacgcgctaaaaatcaa
aaaacactcccgacaattcttaaaaatgagcgcaagataaatttatttttacgcacaaat
gacattgattttattgaagaaatatcgagagaaacaaatttgcaacaacctgaagagcga
tttgcatggttacggtcaaagaaagataacttctaa

DBGET integrated database retrieval system