KEGG   Enterobacter lignolyticus SCF1: Entcl_3529Help
Entry
Entcl_3529        CDS       T01342                                 

Definition
(GenBank) Lytic transglycosylase catalytic
  KO
K08307  membrane-bound lytic murein transglycosylase D [EC:4.2.2.-]
Organism
esc  Enterobacter lignolyticus SCF1
Brite
KEGG Orthology (KO) [BR:esc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:esc01011]
    Entcl_3529
Enzymes [BR:esc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     Entcl_3529
Peptidoglycan biosynthesis and degradation proteins [BR:esc01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   Entcl_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT LysM HTH_Tnp_1 MLTD_N
Motif
Other DBs
NCBI-ProteinID: ADO49771
UniProt: E3G8A3
Position
3777571..3778938
Genome map
AA seq 455 aa AA seqDB search
MKARAILLASVLLVGCQASKNGANIQQHAQSLSAASQGEAGKFAGQARWMDDGTFYAQDQ
DLWAFIGGELKMGIPENPRIREQKQKYLRNKSYLHDVTLRAEPYMYWIAGQVKKRNMPME
LVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRGYDARRDVVASTTAALDMM
QRLNKMFDGDWLLTVAAYNSGEGRVMKAVKTNKARGKPTDFWSLSLPQETKVYVPKMLAL
SDILKNSKRYGVQLPTADESRALARVRLDSPVEMKQLADMAGISVNKLKTFNAGVKGSTL
GASGPKYVLVPQKHADQLRESLASGDIAAVQPTQVADNAPLTSRSYTVRSGDTISGIASR
LGVTAKDLQQWNKLRGSSLKVGQSLTVGAGSSAERLARNSDSITYRVRKGDSLSSIAKRH
GVDIRDVVRWNSDTQNLQPGDQLTLYVKNNDRPDS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacgagcgatattactcgcctctgtcctgctcgttgggtgccaggcgtcgaag
aacggcgccaacattcagcagcacgcacagagcctttctgcggctagtcaaggggaagca
ggaaagtttgcaggtcaggcgcgatggatggatgatggaaccttctatgcgcaggatcag
gatctgtgggctttcattggcggcgagctaaagatgggaattccggaaaatccccggatt
cgcgaacagaaacagaagtatttacgtaataagagctatctccacgatgtaactttacgg
gcagagccgtatatgtactggatagcagggcaagtgaagaaacgtaacatgcccatggaa
ctggtactactacccatagtggagagcgcttttgacccacacgcgacgtctggcgccaat
gccgcaggcatttggcagatcattccgagcaccgggcgcaattatggtttaaaacagacc
cgcggctatgacgcgcgtcgcgatgttgtcgcatcgactacggctgcactcgatatgatg
cagcgtctgaacaagatgtttgacggcgactggctgttgacggtcgcggcctacaacagc
ggcgaagggcgcgtcatgaaagcagtgaaaaccaacaaagcgcgtggtaaacccaccgat
ttttggtcgctttcgctgcctcaggaaacaaaggtctatgtgcctaaaatgctggcattg
agtgatattctcaaaaacagcaagcgctatggcgtacagctgccgacggcagacgaaagc
cgcgcgctggcacgtgtccgtctggacagcccggtagaaatgaagcaattggccgatatg
gcgggtatctcagtcaacaagctgaagaccttcaatgctggcgtaaaagggtcaaccctt
ggcgcaagtggtccaaagtatgtgctggtgccgcaaaaacatgccgaccagctgcgtgaa
tcgctggcatcaggtgacattgcagcagtacagcctactcaggttgctgataatgccccg
ctgaccagccgtagctacacggtacgctccggcgatacgatttccggcattgcttcacgc
ctgggcgtgacggcaaaagacctgcagcagtggaacaagctgcgcggttcaagtctgaaa
gtcggccagagcctgacggtaggcgcaggcagcagcgcggaacgccttgcccgcaacagc
gatagcattacctatcgcgtacgcaaaggtgattcgctttcgagcatcgctaaacgccac
ggtgtcgacatccgcgatgtcgtccgctggaacagcgatacgcagaacctgcagccgggc
gatcagctgacgttgtatgtgaaaaacaacgacagacctgactcctga

DBGET integrated database retrieval system