KEGG   Enterobacter lignolyticus SCF1: Entcl_3531Help
Entry
Entcl_3531        CDS       T01342                                 

Definition
(GenBank) Endonuclease/exonuclease/phosphatase
Organism
esc  Enterobacter lignolyticus SCF1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Motif
Other DBs
NCBI-ProteinID: ADO49773
UniProt: E3G8A5
Position
complement(3779855..3780634)
Genome map
AA seq 259 aa AA seqDB search
MRYVAGQPAERILPPGSFASIGQALPAGVPLSSEEKIRVLVWNIFKQQRAEWLSVLKNFG
KDAHLMLLQEAQTTPELLRFATANYLAADQVPAFVLPQHPSGVMTLSAAHPVYCCPLRER
EPILRLAKSALVTVYPLPDRRLLMVVNIHAVNFSLGVDVYSKQLLPIGDQIAHHSGPVIM
AGDFNAWSRPRMNALYRFAREMSLREVRFTDDHRRRAFGRPLDFVFYRGLNVHDASVLVT
RASDHNPLLVEFSPGKPER
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatgtcgccggacagcccgctgagaggattttacctcccggttcgttcgcgagc
atcggtcaggcgttacccgcgggcgttccattaagcagcgaagagaagatccgcgtactg
gtatggaatatctttaagcagcagcgggccgagtggctgtcggtgctgaaaaactttggc
aaagatgcgcatctgatgctgttgcaggaggcgcagaccactcccgaactgctccggttt
gcaaccgctaactatctcgccgcggatcaggtgccggcctttgtgctgccgcagcacccg
tcaggcgtaatgacgctttctgccgcgcatccggtctactgttgcccgctgcgcgagcgg
gagcctattttacggctggccaaatccgctcttgtgaccgtttatccgttaccggacagg
cgtctgctgatggtggtcaatatccacgccgttaacttcagcctcggcgttgatgtttat
agtaagcagttacttcccatcggcgaccagatagcgcatcactcggggccggttatcatg
gcgggtgacttcaacgcatggagccgcccgcgtatgaatgcgctgtaccgctttgcgcgc
gaaatgtcgctgcgcgaggtgcgtttcaccgacgatcaccgccgccgtgcgtttggccgt
cctcttgattttgtcttctatcgtggtctgaatgtgcacgatgcttccgtgctggtgacg
cgcgcctccgaccataatccgctactcgtagaattcagtcccggcaaacctgaacgctaa

DBGET integrated database retrieval system