KEGG   Enterobacter lignolyticus SCF1: Entcl_3541Help
Entry
Entcl_3541        CDS       T01342                                 

Definition
(GenBank) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00970  Aminoacyl-tRNA biosynthesis
Module
esc_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:esc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Entcl_3541
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:esc01007]
    Entcl_3541
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:esc03016]
    Entcl_3541
Enzymes [BR:esc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     Entcl_3541
Amino acid related enzymes [BR:esc01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   Entcl_3541
Transfer RNA biogenesis [BR:esc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Entcl_3541
 Prokaryotic Type
    Entcl_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b tRNA_edit HGTP_anticodon TIR_2
Motif
Other DBs
NCBI-ProteinID: ADO49783
UniProt: E3G8B5
Position
3794220..3795938
Genome map
AA seq 572 aa AA seqDB search
MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPTGVRVLKKVENIVREE
MNNAGAIEVLMPVVQPSELWQESGRWEQYGPELLRIADRGDRPFVLGPTHEEVITDLIRN
ELNSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHTSQESLQETYDAMYTA
YSKIFSRMGLDFRAVQADTGSIGGSASHEFQVLAQSGEDDVIFSDTSDYAANIEFAEALA
PSAPRAAATQEMTLVDTPNAKTIAELVEQFSLPIEKTVKTLLVKAVEDSAYPLVALLVRG
DHELNEVKAEKLPQVASPLTFATEEEIRAVVNAGPGSLGPVNLPIPVVIDRTVAAMSDFA
AGANVDGKHYFGINWDRDVATPEVADIRNVVAGDPSPDGQGTLMIKRGIEVGHIFQLGTK
YSQAMNAAVQGEDGRNQILTMGCYGIGVTRVVAAAIEQNYDERGIVWPDAIAPFQVAILP
MNMHKSYRVQELAEKLYAELRAQGIEVLMDDRKERPGVMFADMELIGIPHTVVIGDRNLD
NDDIEYKYRRNGDKQLIKTGDILDYLVKAIKG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcgtactagccaatacctgctctccactctgaaggagacacctgccgacgccgaagtc
atcagtcatcagctgatgctgcgcgccgggatgatccgcaagctggcctccgggttatac
acctggctgccgaccggcgtgcgcgtcctgaaaaaagtcgaaaacatcgtgcgtgaagag
atgaacaacgccggtgcgatcgaggtgttaatgccggtagttcagccatctgaactgtgg
caagagagcggccgttgggaacaatacggcccggaactgctgcgtattgctgaccgtggc
gatcgtccattcgtccttggcccaacgcacgaagaagtgatcaccgatctgattcgtaac
gagctgaactcttacaaacagctgccgctgaacttctaccagatccagaccaaattccgt
gatgaagtgcgtccgcgtttcggcgtcatgcgctcccgcgaattcctgatgaaagatgcg
tactctttccatacctcacaggaatccttgcaggaaacctacgacgcgatgtacaccgcc
tacagcaaaatcttcagccgtatgggcctggatttccgcgccgttcaggctgacaccggc
tctatcggcggcagcgcgtctcacgaattccaggtgctggcgcagagcggcgaagatgac
gttatcttctctgatacctctgattacgccgccaatatcgagtttgccgaggccctggcg
ccatcagcgccgcgcgccgccgctacgcaagagatgacgctggtggatacgccgaacgcc
aaaaccatcgccgagctggttgagcagttcagtctgccgattgagaaaacggtgaaaacg
ctgctggtaaaagccgtagaagacagcgcttatccgctggtcgccctgctggttcgcggc
gatcacgagctgaacgaagtcaaagcggaaaaactgccgcaggtcgccagcccgctgacc
ttcgccaccgaagaggaaattcgcgcggtcgtgaatgcaggccctggctctctgggcccg
gtcaacctgccgattccggtcgtcattgaccgtaccgttgccgcaatgagcgatttcgcc
gcaggcgctaacgttgacggtaaacactacttcggtatcaactgggatcgcgatgtcgct
accccggaagtcgccgatatccgcaacgtcgtcgccggcgatccgagcccggacggtcag
ggaaccctgatgatcaaacgcggtatcgaggttggccacatcttccagctgggcaccaag
tactcccaggcaatgaacgctgccgttcagggcgaagatggtcgtaaccagatcctgacc
atgggctgctacggtatcggggtaacgcgcgtcgtggctgccgccattgagcagaactac
gacgagcgcggtatcgtctggcctgacgccatcgccccgttccaggtcgcgattctgccg
atgaacatgcacaaatcctaccgcgtgcaggagctggcggagaaactgtacgccgaactg
cgcgcacagggcatcgaagtgctgatggatgaccgtaaagagcgcccgggcgtgatgttt
gccgatatggagctcatcggtattccgcataccgttgttatcggcgatcgcaacctcgac
aacgacgatatcgaatacaaataccgtcgcaacggcgacaagcagctgatcaagaccggc
gacattctggattacctggttaaggccattaaaggctaa

DBGET integrated database retrieval system