KEGG   Enterobacter lignolyticus SCF1: Entcl_3545Help
Entry
Entcl_3545        CDS       T01342                                 

Definition
(GenBank) Class I peptide chain release factor
  KO
K15034  ribosome-associated protein
Organism
esc  Enterobacter lignolyticus SCF1
Brite
KEGG Orthology (KO) [BR:esc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:esc03012]
    Entcl_3545
Translation factors [BR:esc03012]
 Prokaryotic Type
  Release factors
   Entcl_3545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RF-1
Motif
Other DBs
NCBI-ProteinID: ADO49786
UniProt: E3G8B8
Position
complement(3797882..3798304)
Genome map
AA seq 140 aa AA seqDB search
MIVISRGVVLADDEVEITAVRAQGAGGQHVNKTSTAIHLRFDIRASSLPEEYKTRLLAAS
HHLISAEGVIIIKAQEYRSQEMNREAALARLVSVIQTLTVVQKRRKATRPTKASKERRLT
SKSQKSSVKALRGKVRHSGE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtaatttcgcgcggcgtcgttctggcggacgatgaggttgagataaccgccgtc
agggctcagggcgcggggggacagcacgttaataagacgtcgacggctatccatctgcgc
tttgatattcgcgcgtcgagcctgcctgaggagtataagacgcggctcctggcagccagc
caccacttaatttctgcggaaggtgtgattatcataaaggcgcaggaatatcgtagccag
gagatgaaccgcgaggcggcgctggcccggctggtgtcggtgatacaaacgttgaccgta
gtgcagaagcgtcgtaaagcgacgcgtccgaccaaagcgtcaaaagagcgcaggctgacg
tccaagtcacaaaagtcgtcggtaaaagcgctacgggggaaagtccgccattccggtgaa
tag

DBGET integrated database retrieval system