KEGG   Enterobacter lignolyticus SCF1: Entcl_3547Help
Entry
Entcl_3547        CDS       T01342                                 

Definition
(GenBank) protein of unknown function UPF0253
Organism
esc  Enterobacter lignolyticus SCF1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0253 UPF0147
Motif
Other DBs
NCBI-ProteinID: ADO49788
UniProt: E3G8C0
Position
3799041..3799241
Genome map
AA seq 66 aa AA seqDB search
MEKYCELIRKRYAEIASGDLGYIPDALGCVLKVLNEVAADDAISKSVREKAAFAAANLLV
SDYVDE
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaatattgtgagttaatacgcaagcggtatgcggaaattgccagcggggactta
gggtatatcccggatgcgctgggttgtgtgctaaaagtattgaatgaagtggcggctgat
gacgcgatttcaaagtcggtcagagaaaaagcggcctttgcggcggcaaacttactggtg
agcgattatgtcgatgaatga

DBGET integrated database retrieval system