KEGG   Enterobacter lignolyticus SCF1: Entcl_3550Help
Entry
Entcl_3550        CDS       T01342                                 

Definition
(GenBank) Glyoxalase/bleomycin resistance protein/dioxygenase
  KO
K08234  glyoxylase I family protein
Organism
esc  Enterobacter lignolyticus SCF1
Brite
KEGG Orthology (KO) [BR:esc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    Entcl_3550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3 Glyoxalase_6 Glyoxalase_2
Motif
Other DBs
NCBI-ProteinID: ADO49791
UniProt: E3G8C3
Position
complement(3800813..3801205)
Genome map
AA seq 130 aa AA seqDB search
MLGLKQIHHIAIIASDYAKSKAFYCDTLGFTLQSEFYREARDSWKGDLALNGHYTIELFS
FPFPPPRPSRPESCGLRHLAFSVDDIDAAVAHLEGHGVKCEAIRIDPFTNKRFTFFNDPD
GLPLELYQQS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtttaaaacagattcaccatatcgccatcatcgccagcgattacgcgaagagt
aaggcgttctactgcgacactctggggtttaccctgcaaagcgagttttaccgcgaggcg
cgggattcgtggaagggcgacctggcgctgaacgggcactacactatcgagctgttctct
tttccttttccaccgccgagaccatcgcgtccggagtcctgcggcctgcgtcatctggcg
tttagcgtggacgatatcgacgcggcggttgcgcatctggaaggccacggcgtgaagtgc
gaggcgatccgtatcgatccgtttacgaacaagcgctttaccttttttaacgatccggac
ggtctgccgctggagctgtatcaacagtcatga

DBGET integrated database retrieval system