KEGG   Enterobacter lignolyticus SCF1: Entcl_3552Help
Entry
Entcl_3552        CDS       T01342                                 

Definition
(GenBank) acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00061  Fatty acid biosynthesis
esc00620  Pyruvate metabolism
esc00640  Propanoate metabolism
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
esc01200  Carbon metabolism
esc01212  Fatty acid metabolism
Module
esc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Entcl_3552
   00640 Propanoate metabolism
    Entcl_3552
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Entcl_3552
Enzymes [BR:esc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Entcl_3552
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Entcl_3552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE
Motif
Other DBs
NCBI-ProteinID: ADO49793
UniProt: E3G8C5
Position
complement(3803502..3804461)
Genome map
AA seq 319 aa AA seqDB search
MSLNFLDFEQPIAELEAKIDSLTAVGRQDEKLDINIDEEVHRLREKSVELTRKIFADLGA
WQVAQLARHPLRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMVIGHQK
GRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFIDTPGAYPGVGAEERGQSEA
IARNLREMSRLSVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKS
ADKAPLAAEAMGIIAPRLKELKLIDAVIPEPLGGAHRNPEVMAASLKAQLLADLADLDVL
SKDDLLNRRYQRLMGYGYA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaatttccttgattttgagcagccaattgcagagctggaagcgaaaatcgat
tccctgactgccgttggccgtcaggatgaaaaactggatattaacatcgacgaagaagtt
catcgtctgcgcgaaaagagcgttgagctgacgcgtaaaatcttcgccgatctcggtgca
tggcaggtagcccagctggctcgccatccgctgcgtccgtacaccctggattatgtccgc
ctggcgttcgacgagtttgacgaactggccggggaccgcgcttacgctgatgataaagcg
atcgtcggcggtattgcgcgtcttgatggtcgtccggtgatggtgattggccaccagaaa
ggccgtgaaaccaaagagaagatccgtcgtaacttcggtatgccggcgccggaaggctac
cgcaaagcgctgcgtctgatggaaatggcggaacgctttaatatgccgattatcaccttc
atcgacaccccgggcgcgtatccgggcgttggtgcggaagagcgcggccagtctgaagcg
attgcccgcaacctgcgtgaaatgtcgcgcctgagcgtaccggttatctgtaccgttatc
ggtgaaggcggctccggcggcgcgctggcaatcggcgtcggcgataaagtgaacatgctg
cagtacagcacctactccgttatctctccggaaggctgcgcctccattctgtggaagagt
gcggataaagcgccgctggcggcggaagccatgggtatcatcgcgccgcgcctgaaagag
ctgaagcttatcgacgctgtgatcccggaaccgctgggcggcgcccaccgtaacccggaa
gtcatggcggcaagcctgaaggcgcagctgctggctgacctcgcggacctggacgtgctg
agcaaagacgatctgctgaaccgtcgctatcagcgtctgatgggctacggctacgcgtaa

DBGET integrated database retrieval system