KEGG   Enterobacter lignolyticus SCF1: Entcl_4090Help
Entry
Entcl_4090        CDS       T01342                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00010  Glycolysis / Gluconeogenesis
esc00620  Pyruvate metabolism
esc00640  Propanoate metabolism
esc00680  Methane metabolism
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01120  Microbial metabolism in diverse environments
esc01130  Biosynthesis of antibiotics
esc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:esc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entcl_4090
   00620 Pyruvate metabolism
    Entcl_4090
   00640 Propanoate metabolism
    Entcl_4090
  Energy metabolism
   00680 Methane metabolism
    Entcl_4090
Enzymes [BR:esc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Entcl_4090
Lipid biosynthesis proteins [BR:esc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Entcl_4090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADO50323
UniProt: E3G2A6
Position
4403919..4405877
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPAPIAERCLINPEQYKAKYHQSITDPDAFWGEQGNILDWITPYTKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLAERGSQTAIIWEGDDASQSKHISYQELHRDVCRF
ANTLQSLGIKKGDVVAIYMPMVPETAVAMLACARIGAVHSVIFGGFSPEAVAGRIVDSSS
RLVITADEGLRAGRAIPLKKNVDEALKNPNVKSVEHVIVLKRTGGDIAWNDGRDLWWSDL
IDKASDQHTPVAVNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAATTFKYVFDYHQGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVNILYTAPTA
IRALMAEGDKAVQGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVIDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGHPLDGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHSIKGQAIYAYVTLNHGEEPSPALYTEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQSITMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacataaacaccctattcccgctccgattgcggaacgctgcctgattaac
ccggaacagtacaaggcaaaataccaccagtccatcaccgatcctgacgccttctggggc
gaacagggtaacatccttgactggataaccccctacacgaaggtgaaaaacacctccttt
gccccaggcaacgtctcgatcaaatggtatgaagacggcaccctgaacctggcggccaac
tgcctcgaccgccatctggccgaacgcggctcgcagaccgccatcatctgggaaggcgac
gacgccagccagagcaaacacatcagctaccaggagctgcatcgcgacgtctgccgcttc
gccaataccctgcagtctctgggcattaaaaaaggcgatgtcgtcgctatctatatgccg
atggtgccggaaacggcggtggcgatgctggcctgcgcgcgcatcggcgccgtgcactcg
gtgattttcggcggcttttcgccggaagcggtcgccgggcgcatcgttgactccagctcg
cgtctggtgatcaccgccgacgaaggtctgcgcgccgggcgggcgatcccgctgaagaaa
aacgtcgacgaagcgctgaaaaatccgaacgtgaagagcgttgagcacgtcattgttctc
aagcgtactggcggcgacatcgcctggaacgacggccgcgacctgtggtggagcgacctt
atcgacaaggccagcgaccagcataccccggtagcggtgaacgccgaggacccgctgttc
atcctctatacctccggctccaccggcaagccgaaaggcgtggtgcacaccaccggcggc
tacctggtgtatgccgcaaccacctttaaatacgtctttgattaccatcagggcgacatc
tactggtgcaccgccgacgtgggctgggtgaccggccatagctacctgctttatgggccg
ctggcctgcggcgccaccaccctgatgtttgaaggggtgccgaactggccaacgccggcg
cgcatgtgccaggtcgttgataagcataaggtcaacattctctacaccgcgccgaccgcg
atccgcgcgctgatggccgaaggcgataaagccgtgcagggcaccgaccgctcgtccctg
cgtattctgggctccgtcggcgagccgattaacccggaagcctgggagtggtactggaag
aaaatcggcaacgagaagtgcccggtgatagacacctggtggcagaccgaaaccgggggc
ttcatgattaccccgctgccgggcgcgaccgagctgaaagccgggtcggcaacccgtccg
ttcttcggcgttcagcctgcgctggtggataacgaagggcatccgctcgacggcgcgacc
gagggcaacctggtcatcaccgactcctggcctggccaggcgcgcacgctgttcggcgac
cacgagcgttttgagcagacctacttctcgaccttcaagaacatgtacttcagcggcgac
ggcgcgcgccgtgacgaagacggctactactggataaccggtcgcgtcgacgatgtgctg
aacgtttccggccaccgtctgggcaccgccgagattgaatccgcgctggtctcgcatccg
aaaatcgccgaagccgcggtggtgggcattccgcacagcatcaaggggcaggccatttac
gcctacgtgacgctgaaccacggcgaagaaccgtcgccggcgctgtacaccgaggtgcgt
aactgggtgcgtaaggagattggcccgctggcgacgccggacgtgctgcactggaccgac
tcgctgccgaaaacccgctccggcaaaatcatgcgccgtattctgcgcaaaatcgccgcc
ggcgataccagcaatcttggcgacacctcgacgctggcggatccgggcgtcgtggaaaaa
ctgcttgaagagaagcagtccattaccatgccgtcataa

DBGET integrated database retrieval system