KEGG   Enterobacter lignolyticus SCF1: Entcl_4326Help
Entry
Entcl_4326        CDS       T01342                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00670  One carbon pool by folate
esc01100  Metabolic pathways
esc01120  Microbial metabolism in diverse environments
esc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Entcl_4326
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Entcl_4326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ADO50556
UniProt: E3G4T8
Position
complement(4681169..4682059)
Genome map
AA seq 296 aa AA seqDB search
MSFFHANQREALNQSLAELDGQINVSFEFFPPRTSEMEQTLWASIDRLSSLKPKFVSVTY
GANSGERDRTHSIIKGIKERTGLEAAPHLTCIDATRDELRAIAQDYWNNGIRHIVALRGD
LPPGSGKPDMYAADLVTLLKEVGDFDISVAAYPEVHPEAKSAQADLLNLKRKIDAGANRA
ITQFFFDVESYLRFRDRCAATGIDVEIVPGILPVSNFKQAKKFADMTNVRIPAWMAKMFD
GLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPAV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttttcacgccaaccagcgggaagccctgaatcagagcctggccgagttagat
ggccagattaacgtttcctttgagtttttcccgccgcgcaccagtgaaatggagcagacc
ctgtgggcctctatcgacagactgagcagcctgaagcccaaatttgtctccgtgacctac
ggcgcgaactccggcgagcgcgaccgcactcacagcatcatcaaagggatcaaagagcgt
acgggcctggaagcggcgccgcacctgacctgtattgacgctacccgcgacgagctgcgc
gccatcgctcaggactactggaacaacggcatccgccatatcgtggcgctgcgcggcgat
ttaccgccaggcagcggcaagccggacatgtatgccgccgatctggtgacgctgctcaaa
gaggtgggggatttcgatatttccgtggccgcctacccggaagttcacccggaggcgaaa
agcgcgcaggcggatctgctgaacctgaagcgcaagattgatgccggggctaaccgcgcc
atcacccagtttttctttgacgttgaaagctacctgcgctttcgcgaccgctgcgccgcg
accggtattgatgtcgaaatcgtccccggtattctgccggtctcaaactttaagcaggcg
aagaagtttgccgacatgaccaacgtgcgtattccggcctggatggcgaaaatgtttgac
ggtctggatgatgatgcggaaacccgcaagctggtcggcgcgaatatcgccatggatatg
gtgaaaattctcagccgcgaaggggtgaaagatttccacttttataccctgaaccgcgcc
gaaatgagctacgctatttgccacacgctgggcgtgcgtccggccgtataa

DBGET integrated database retrieval system