KEGG   Enterobacter lignolyticus SCF1: Entcl_4335Help
Entry
Entcl_4335        CDS       T01342                                 

Definition
(GenBank) O-succinylhomoserine (thiol)-lyase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc00270  Cysteine and methionine metabolism
esc00450  Selenocompound metabolism
esc00920  Sulfur metabolism
esc01100  Metabolic pathways
esc01110  Biosynthesis of secondary metabolites
esc01130  Biosynthesis of antibiotics
esc01230  Biosynthesis of amino acids
Module
esc_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:esc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Entcl_4335
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Entcl_4335
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Entcl_4335
Enzymes [BR:esc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     Entcl_4335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADO50565
UniProt: E3G4U7
Position
complement(4690363..4691523)
Genome map
AA seq 386 aa AA seqDB search
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLARRGCYRVL
FVDQGDEQALCAALAEKPKLVLVESPSNPLLRVVDIAKICRLARDAGAVSVVDNTFLSPA
LQNPLALGANLVLHSCTKYLNGHSDVVAGVVIAKEEETVTELAWWANNIGVTGSAFDSYL
LLRGLRTLSPRMEVAQRNAQAIVDFLRQQPLVKKLYHPSLPENQGHEIAARQQKGFGAML
SFELDGDEQTLRRFLSGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLL
RISTGIEDCEDLIADLENGFRAAKEG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtaaacaggccaccatcgcagtgcgtagcgggttaaatgacgacgaacagtat
ggctgcgttgtcccgccaattcatctttccagcacctataattttaccggttttaacgag
cctcgcgcccacgactactcgcgtcgcggcaacccgacgcgcgacgtcgtgcagcgcgcg
ctggcggaactggaaggaggcgcaggcgcggtgttgaccaataccggcatgtcggctatt
catctggtcaccaccgtttttctcaagcccggcgacctgttggtggcgccgcacgactgc
tacggcggcagctatcgcctgtttgatagccttgcccggcgcggctgctatcgcgtgctg
ttcgtcgatcagggcgatgagcaggcgctgtgcgcggcactggcggagaaaccgaagctg
gttttagtcgaaagcccaagtaacccattgttgcgcgtcgttgatattgcgaaaatctgt
cgcctggcgcgcgacgcgggggcggtgagcgttgtggataacaccttcctgagcccggcg
ctgcaaaatccgctggcgctgggggccaatctggtgctgcactcgtgcaccaaatacctg
aacggccactccgatgtggtcgccggggtggtgatcgccaaagaggaagagaccgtcacc
gagctggcatggtgggcgaataatatcggcgtcaccggcagcgcgttcgacagctacctg
ctgctgcgtggcttgcgtacgctgtcgccgcgcatggaggtggcgcaacgcaacgcgcag
gcgattgtcgatttcctcaggcagcagccgctggtgaaaaagctgtaccacccgtcgctg
ccggaaaaccaggggcacgaaattgccgcccgccagcaaaaagggttcggcgcgatgctc
agctttgagctggatggcgacgaacaaacgcttcgccgctttttaagcgggctgtcgctg
tttacactggcggaatcgctgggcggggtggagagcctgatctcccatgccgccaccatg
acccacgcgggcatggcgccggaagcccgcgcggcggccggtatttctgagacgctgtta
cgtatctcaaccggtattgaagattgtgaagatttgattgccgacctggaaaatgggttc
cgggcagcaaaagaggggtaa

DBGET integrated database retrieval system