KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_2540Help
Entry
ECSF_2540         CDS       T02077                                 

Definition
(GenBank) survival protein
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
ese00230  Purine metabolism
ese00240  Pyrimidine metabolism
ese00760  Nicotinate and nicotinamide metabolism
ese01100  Metabolic pathways
ese01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ese00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECSF_2540
   00240 Pyrimidine metabolism
    ECSF_2540
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECSF_2540
Enzymes [BR:ese01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     ECSF_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: BAI56080
Position
complement(2762793..2763554)
Genome map
AA seq 253 aa AA seqDB search
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGD
IAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLDGHKHYDTAAAVTCSILRALCKEPLRTGRILNINVPDLPLDQIKGIRVTRCGTRH
PADQVIPQQDPRGNTLYWIGPPGGKCDAGPGTDFAAVDEGYVSITPLHVDLTAHSAQDVV
SDWLNSVGVGTQW
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatattgctgagtaatgatgacggggtacatgcacccggtatacaaacgctggcg
aaagccttgcgtgagtttgctgacgttcaggtggtcgcccccgatcgtaaccgcagcggc
gcttctaattctctgacactggaatcttccctgcgcacgtttacctttgaaaatggtgat
attgctgtgcaaatgggaaccccgaccgattgcgtctatcttggcgtaaatgctctgatg
cgcccgcgcccggacattgttgtgtccggaattaacgccgggccgaatctgggggatgat
gttatttattccggtacggtagcggccgcgatggaaggccgtcatttaggttttccggcg
cttgccgtctcgcttgacgggcataaacattacgacactgccgcggcggtaacctgctca
attttgcgcgcattgtgtaaagagccgctgcgcaccgggcgtattcttaatattaacgtt
ccggatttaccattggatcaaatcaaaggtattcgcgtgacgcgctgcggtacacgacat
ccggcagatcaggtgatcccgcagcaagatccgcgcggcaatacgctgtactggattggc
ccgccgggcggtaaatgtgatgccggtccggggaccgattttgctgcggtagatgagggc
tatgtttccatcacgccgctgcatgtggatttaactgcgcatagcgcgcaagatgtggtt
tcagactggttaaacagcgtgggagttggcacgcaatggtaa

DBGET integrated database retrieval system