KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_2605
Entry
ECSF_2605         CDS       T02077                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Brite
KEGG Orthology (KO) [BR:ese00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ese02044]
    ECSF_2605
Secretion system [BR:ese02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECSF_2605
SSDB
Motif
Pfam: T6SS_VipA GerD Imm65
Other DBs
NCBI-ProteinID: BAI56145
Position
2836787..2837287
AA seq 166 aa
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINK
NNFNSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMR
NLLRDLKSNLLDNATFRRELENILKDPTLSSELRDELAKIAPQENV
NT seq 501 nt   +upstreamnt  +downstreamnt
atggccgacagtttccagaatgaagttcccgccgctcgtgtaaatatcaagcttgacctg
catacaggcaatgctaaaaagaaagttgaactccccctcaagcttcttgccgtaggcgat
tacagtaacggaaaagagcagcgtccgctgtccgaacgggacaagattgatatcaataaa
aacaacttcaacagcgtcatggctgagttttcgcctgcggttaatttaacagtagaagat
acgctaaacggaaacggtaatgaacaaaatatcgcgcttgaatttaaaagcctgaaggat
tttgagcccgaacaggtagcaaaaaatattccacaacttcgtgtattactcgctatgcgc
aatttactacgtgacctgaaatccaatctgctggataacgcaacgtttcgccgtgaactg
gaaaatatcctgaaagacccgacgctcagttcagaactgcgtgatgaactggcgaaaatt
gcgccgcaggagaacgtttaa

DBGET integrated database retrieval system