KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_2623Help
Entry
ECSF_2623         CDS       T02077                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Brite
KEGG Orthology (KO) [BR:ese00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ese02044]
    ECSF_2623
Secretion system [BR:ese02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECSF_2623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: BAI56163
Position
2862632..2863711
Genome map
AA seq 359 aa AA seqDB search
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQRQQNAPLGSTDSPAADAVRFRPHPGM
GFPVSELKNVERDVDNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLD
IFNHRFITQYYRIWRKYNYPASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLAL
LSVMRLPTRTAEGVTALVGLLAPLTKATVVPHDPQPVILPAPAGLSKNSPISLKTRTLLG
RTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLRVYLGWRCQARLQLTLPVSLL
PAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLTPAFSIRNRESMTHVSYSF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacagagcatcacagccagcgcgtaccgggctgaccgaccggctggccccggatatt
gcgcggatcaatttttaccgtttttgccagttgctggaacagcgccagcagaacgcgccg
ctgggcagtaccgacagccccgccgccgatgcggtgcgctttcgtcctcatccggggatg
ggctttccggtcagcgagttaaagaacgttgaacgtgacgtggacaatcccgacgcgcca
cccacagtgcgcaccacttttctcggcctgtacggcgtggattcgccactgccaaccgcc
tatctggactacattacccagcgtcatgacggacatgacgcggtgatggcgtttctcgat
atttttaaccatcgctttatcacccagtattaccgcatctggcgcaaatataactacccg
gcgtcgtttgaagcaggtgcagtggatgacatttcccgttgcctgctgggactcatcggg
ctgggtattcccggcagcgagaaccatatcgccacgccggtatcccgttttctggccctg
ctcagcgtgatgcgcctgccgacgcgcacggcggaaggcgttacggcactggtgggactg
cttgccccgctgacgaaagcgacggtggtgcctcatgatccgcagcctgtaattctcccg
gcccctgcgggtctgtcaaaaaattcacccatcagcctgaaaacgcgaacgctgctgggg
cgtaccggcaccgacgtcaacagccagttgctgctgaaactgtataccgaagatgccgca
gaagcacgtggctggctgcccggcgggcaactgcacagcgatttgctggtgctgctgcgc
gtttatctgggctggcgctgtcaggcccgactgcaactgacgctgcccgtcagcctgttg
cctgctgcccggctgggaaaacagcgtgtacagattagccgtaccggcatccttcgcgcc
tcctttgccgcgcccgcgaccggaacagtgacggtcagtctggggcgttatcagggatta
acacccgctttttccattcgtaacagggagagtatgactcatgtttcctattcgttttaa

DBGET integrated database retrieval system