KEGG   Exiguobacterium sibiricum: Exig_0607
Entry
Exig_0607         CDS       T00687                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00620  Pyruvate metabolism
esi00640  Propanoate metabolism
esi00650  Butanoate metabolism
esi01100  Metabolic pathways
esi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Exig_0607
   00640 Propanoate metabolism
    Exig_0607
   00650 Butanoate metabolism
    Exig_0607
Enzymes [BR:esi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Exig_0607
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACB60088
UniProt: B1YK07
Position
complement(641537..643789)
AA seq 750 aa
MMLLEKTPAWQQFETGAWNNQIDVADFIRRNRTEYRGDDQFLAGPTVATETLWQQIMNLT
SEERLRGGVYAVDASTPSTILSHGPGYLNRELEQIVGLQTDEPFKRSIHPNGGIRMVNDA
LEAYGFQADPLVTKTFSEYRKTHNQGVFDAYTPEMRAARKAGIITGLPDAYGRGRIIGDY
RRVALYGTSFLIAQRKQDLQDRGGFLSESMIRDREEMNEQIRALQELTELGQRYDCDLSR
PAETAQEAFQWVYLAYLAAIKEQNGAAMSLGRVSTFLDIYIERDLQTGRLTEQTAQELVD
HFVMKLRIVKFLRTPDYNDLFSGDPTWVTESIGGMSEDGRSNVTKSSFRFLQTLVNLGPA
PEPNLTVLWSTKLPRGFKEFCAKMSILSSSIQYENDDLMLPVYGDDYGIACCVSAMKIGK
QMQFFGARANLAKALLYTLNGGMDEKLKIQVAPKTDLILDDVLDYETVMAAYDRQLDWLA
ELYVNTLNVIHFMHDKYSYERLEMALHDPEILRTMACGIAGLSVVADSLSAIRYATVSPI
RDADGIAVDFKIEGDFPKFGNNDERVDQMAVDLVKLFMEKIRKHPTYRDALPTQSVLTIT
SNVVYGKKTGNTPDGRRAGEPFAPGANPMHGRDTKGAVAALTSVGKLPYEHALDGISYTF
SIVPKALGKDEPTRIRNTVGLLDGYMGGTTSKGHHLNVNVFDRETLLDAMEHPELYPQLT
IRVSGYAVNFIKLTREQQIDVINRTFHGAL
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgatgttacttgaaaaaacgccagcatggcaacaattcgaaacaggcgcgtggaacaat
cagattgacgtggctgatttcattcgccgcaaccggacagagtaccggggagacgatcag
tttctcgccggtcctaccgttgctacggaaacactgtggcaacaaatcatgaatttaaca
agtgaagaacgtttacgcggcggggtctatgccgtcgatgcctcgacaccttcaacgatt
ctgtcacacggtccggggtatctcaaccgcgagctcgaacaaatcgtcggtctgcaaacc
gacgaaccgttcaaacggtcgattcacccgaacggcggcatccggatggtcaatgatgcc
ttagaagcttatggttttcaagcggacccgctcgtcaccaaaacgttcagtgaataccgg
aaaacacataatcaaggtgtatttgatgcctatactcctgaaatgcgtgccgcccgtaaa
gccgggatcatcaccggtcttccggatgcatatggacgcgggcggatcatcggtgactac
cgacgggttgccctgtacggtacctccttcctgattgcacagcgaaaacaggatttacag
gaccgtggcggcttcttatcggaatcgatgattcgcgaccgcgaagagatgaacgaacaa
atccgggcgctgcaggaactgaccgaactcggacaacggtatgactgtgatttatcccgt
ccggccgaaaccgcacaggaagcgttccagtgggtgtatctggcttatctcgctgccatt
aaagagcaaaacggcgccgcaatgtcactcggtcgcgtctcgacattccttgacatctac
attgaacgggatttacagaccggtcgtttgacggaacaaacggcacaggaactcgtcgat
cattttgtcatgaaactgcgcatcgtcaaattcctccggaccccggattataatgatcta
ttctccggcgatccgacctgggtcacggaatcgatcggcggaatgagtgaagacggccgc
tccaacgtcaccaaaagttcgttccgcttcctgcagacactcgtcaatctcggtccggct
cccgaaccgaatctgacggtgctttggtcgacaaaactgccgcgcggatttaaagaattc
tgtgccaagatgtcgattctctccagttcgattcagtacgagaacgatgatttgatgctg
ccggtttatggcgatgattacggcatcgcgtgttgtgtttccgccatgaaaatcgggaaa
cagatgcaatttttcggcgcacgggcgaacctcgcaaaagcattactctacacgttaaac
ggcggtatggatgaaaaactcaaaatacaggtcgctccaaagaccgacttgattctcgat
gacgtcctggattatgagacggtcatggctgcttacgaccgccagctcgactggttggcg
gaactttatgtcaatacactgaatgttattcacttcatgcatgataaatacagttacgaa
cgtctcgaaatggcattacacgatccggaaatcttacggacgatggcttgcggtattgcc
ggtctgtctgtcgtcgctgacagcctgtccgcgatccgttacgctaccgtctccccgatc
cgcgatgcggacggaattgcggttgattttaaaatcgagggcgacttcccgaaattcggc
aataacgatgaacgagtcgatcagatggccgttgatctcgtcaaactgttcatggaaaaa
atccggaaacatccgacgtatcgtgatgctttaccgactcaatctgtcctgacgattact
tcgaacgtcgtctacggcaaaaaaaccggtaacacaccggacggacgacgggccggtgaa
ccgttcgcaccaggcgctaatccgatgcacgggcgcgatacgaaaggggctgtcgccgcg
ttgacatccgtcggcaaattaccatatgaacatgcactcgacggcatctcttatacgttc
tcgattgtcccgaaagccctcgggaaagacgaaccgacacgaatccgcaacactgtcgga
ctgctcgacggctatatgggcggaactacttcaaaaggacatcacttaaacgtcaacgtc
tttgaccgggaaacgttgcttgacgcgatggaacatccggaactttatccccagttgacc
atccgggtttccggttacgccgtcaacttcatcaaattgacccgcgaacaacaaatcgac
gtcatcaaccggacattccacggtgcactttaa

DBGET integrated database retrieval system