KEGG   Exiguobacterium sibiricum: Exig_0101Help
Entry
Exig_0101         CDS       T00687                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
esi  Exiguobacterium sibiricum
Pathway
esi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:esi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Exig_0101
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:esi03011]
    Exig_0101
Ribosome [BR:esi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Exig_0101
  Bacteria
    Exig_0101
  Archaea
    Exig_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACB59588
UniProt: B1YGV5
Position
127878..128210
Genome map
AA seq 110 aa AA seqDB search
MQSKASANMVRIAPRKARLVVDLIRGKQIGEALSILAYTNKAATPIVEKVLKSAIANAEH
NFDMNIENLVVTEAYVNEGPTLKRFRPRAMGRASRINKRTSHVHIVVSEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaaaagcatcggctaatatggttcgcattgctcctcgtaaggcacgtctagta
gtagacttaatccgcgggaagcaaatcggtgaagcactttcgattcttgcttacacgaac
aaggcagcaacgccaatcgttgagaaagtattgaaatcggcaatcgcgaacgctgagcac
aacttcgacatgaacatcgaaaacctcgtagtaacagaggcttacgtcaacgaaggtcca
acgctcaaacgtttccgcccacgtgcaatgggtcgcgcaagccgcatcaacaaacgtacg
agccacgttcacatcgtggtatctgaaaaataa

DBGET integrated database retrieval system