KEGG   Exiguobacterium sibiricum: Exig_0135Help
Entry
Exig_0135         CDS       T00687                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00220  Arginine biosynthesis
esi00330  Arginine and proline metabolism
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01130  Biosynthesis of antibiotics
esi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Exig_0135
   00330 Arginine and proline metabolism
    Exig_0135
Enzymes [BR:esi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Exig_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACB59622
UniProt: B1YH90
Position
153056..153964
Genome map
AA seq 302 aa AA seqDB search
MNIAYISVPYRYGQGKPGTEQGPAAVEQAGLLETLAANGQEAVRYGEAAVLSEDAVREED
PQLKRLEGVVHTTNDLHLLVREALTEQRFPLLVGGDHSMAIGTIAGMRQVVPRLGVIWFD
AHGDLNTPETSPSGNIHGMPLAVALGEGHQRLTEIGGDGVKLQPEHLVFIGLRDVDAGEQ
ELIDRLGIRVYDMEAIRTRGMDAIMKEAVAYLKETTDAFYLSFDMDGLDPSLVEGTGTRV
ADGIMLDDAKTVLRHCAEQDEFIAAEFVEVNPLLEEGNGTAILANDLIGNLLQYMRTHRL
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgcatatatcagcgtaccgtatcgttatggtcaaggaaaaccggggacggag
caaggaccagctgccgttgaacaggcaggattactcgaaacactggcagcaaacggacag
gaagcagttcgctacggggaagcggctgttttgtctgaagatgctgttcgtgaagaagat
ccgcaattaaaacggctcgaaggtgttgtccacacgacaaacgatttacacttgcttgta
cgtgaggcgctgacagagcaacgttttccgttactcgtcggaggcgatcacagcatggcg
atcggaacgattgccggtatgcggcaagtcgtaccacgtctcggagtcatctggtttgat
gcacacggcgatttaaatacaccggagacttctccatcggggaacattcacggaatgccg
ctggccgttgccttaggcgaaggacaccagcgtctgacggaaatcggaggggacggggtt
aaactgcaaccggaacacctcgtcttcatcggattacgtgatgtcgatgcaggagaacag
gaattgattgatcgtctcggtatccgtgtctatgatatggaagcgattcggacacgcggg
atggatgccatcatgaaagaagccgttgcctatctcaaagagacgacagatgcgttttat
ctcagctttgatatggacgggctcgatccaagtctggttgaaggaactgggacacgtgtg
gcggacggtatcatgcttgatgatgcgaagaccgttttacgtcactgtgccgagcaggat
gaattcatcgcagcagaattcgtagaggtcaatcctttactcgaagaaggaaacggtaca
gcgattcttgcgaatgacttgattggaaacttgctccagtatatgcggacccatcgttta
gtaaaataa

DBGET integrated database retrieval system