KEGG   Exiguobacterium sibiricum: Exig_0429
Entry
Exig_0429         CDS       T00687                                 

Definition
(GenBank) 2,3-diketo-5-methylthio-1-phosphopentane phosphatase
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00270  Cysteine and methionine metabolism
esi01100  Metabolic pathways
Module
esi_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:esi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Exig_0429
Enzymes [BR:esi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     Exig_0429
SSDB
Motif
Pfam: HAD Put_Phosphatase Hydrolase Hydrolase_3
Other DBs
NCBI-ProteinID: ACB59911
UniProt: B1YIY1
Position
complement(446889..447548)
AA seq 219 aa
MTIRILCDFDGTVTEHDNIIALMTEFAPPEAFEPLKKGVLDQSLSIQSGVGQMFRLLPSD
RKQDYIDFLEQRAVIRPGFKTLLAFAKSNGIDFAIVSGGIDFFVQPILQELLTDEAIYCN
GSDFSGETIRIEWPHTCDAACNNQCGCCKTSIARKLKQDGDIIVTIGDSVTDFELAKQAD
HVYARDYLITLCEQHGIAYTPFETFYDIVDHLQTTEVYA
NT seq 660 nt   +upstreamnt  +downstreamnt
atgacgatccggattttatgtgactttgacgggaccgtgactgaacacgacaatatcatt
gcgttgatgacagaattcgctcccccggaagcgtttgaaccgttgaaaaaaggtgtcctc
gatcaatcgctgtccatccagtccggtgtcggacagatgttccggttgctcccctcggat
cgcaaacaggactatattgattttttggaacagcgggctgtcatccgtcccggctttaag
accttactcgcctttgccaaatcgaacgggattgactttgcgatcgtcagcggcggaatc
gacttttttgtccaaccgattcttcaagagttactgacagatgaagcgatttactgcaac
ggcagtgacttcagcggggagacgattcgtattgagtggccgcacacttgcgatgcagca
tgcaacaatcaatgcgggtgttgtaaaacgtcgattgcccggaagctcaagcaggatggc
gatattatcgtcacgatcggtgactccgtgacggattttgaactggcgaaacaagcggat
catgtctatgcccgcgattatctgattacgctgtgcgaacagcacgggattgcatacaca
ccatttgaaacattttacgacattgttgatcatctgcagacaacggaggtgtacgcatga

DBGET integrated database retrieval system