KEGG   Exiguobacterium sibiricum: Exig_0473Help
Entry
Exig_0473         CDS       T00687                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00220  Arginine biosynthesis
esi00250  Alanine, aspartate and glutamate metabolism
esi00471  D-Glutamine and D-glutamate metabolism
esi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Exig_0473
   00220 Arginine biosynthesis
    Exig_0473
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Exig_0473
Enzymes [BR:esi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Exig_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase WGG
Motif
Other DBs
NCBI-ProteinID: ACB59955
UniProt: B1YJ25
Position
504382..505314
Genome map
AA seq 310 aa AA seqDB search
MNVTQQQLEELIAECRPYTVLGQVASYIPELAKSEPTQLGIAVCNADGSFVSAGDAETMF
TLQSVSKIITLAFVLETFGEDYVFSKVGMEPTGDAFNSIAKLEETIPTKPLNPMINAGAL
AVTSMLPGEDAADKLNRLRQFIADLLDIELDMVKYDAEVAKSEFETTDLNRALLYFMRYH
GVIEGNVEEIIDVYTKQCAILTNCKGLAMMGKILSQSGKTPSGNQVISRRNARIIRAIMT
TCGMYDASGEFSVQVGLPGKSGVSGAIVACGRSDFDMADLGIGIFGPALDLKGNSIAGTK
MLELLVQRHP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaacgcaacaacaactagaagaattaatcgctgaatgccgcccctatacggtg
ctcgggcaggtggcgagttatataccagaactggcaaaatcggaaccgacccaactcgga
atcgctgtttgtaatgcagacggcagttttgtatccgcgggagacgccgaaacgatgttc
accttacaaagtgtttcaaaaatcatcacgttagcctttgtcctcgagacatttggtgaa
gattacgtgttctcgaaggtcggtatggaaccgacgggagacgcgttcaactcgattgcg
aagcttgaagagacgattccgacgaaacccctgaatccgatgatcaacgccggagcactc
gctgtgacgagcatgttaccgggggaagatgcagccgataagctgaaccggttacgccaa
ttcattgccgatctgctggatatcgaactcgatatggtcaaatacgatgcagaggtcgcg
aagtccgaattcgagacgaccgacttaaaccgggctctgctgtacttcatgcggtatcat
ggagtcatcgaagggaacgtcgaagaaatcatcgatgtctatacaaaacagtgtgcgatt
ttgaccaattgtaaaggactcgcgatgatggggaaaattttaagtcaatccggaaaaaca
ccatccgggaatcaagtcatctcccgccggaatgcacggatcatccgggcgatcatgacg
acatgcggcatgtacgatgcgtccggtgaattttcagtccaggtcgggttacccggaaaa
agcggggtatcgggtgcgatcgttgcctgcggtcgcagtgacttcgacatggcggacctt
ggaatcggtatcttcggaccggcacttgacctgaaaggaaattcgattgccggaacgaag
atgctggagttgctcgtccagcgtcatccttaa

DBGET integrated database retrieval system