KEGG   Exiguobacterium sibiricum: Exig_1175Help
Entry
Exig_1175         CDS       T00687                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00071  Fatty acid degradation
esi00072  Synthesis and degradation of ketone bodies
esi00280  Valine, leucine and isoleucine degradation
esi00310  Lysine degradation
esi00362  Benzoate degradation
esi00380  Tryptophan metabolism
esi00620  Pyruvate metabolism
esi00630  Glyoxylate and dicarboxylate metabolism
esi00640  Propanoate metabolism
esi00650  Butanoate metabolism
esi00900  Terpenoid backbone biosynthesis
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
esi01200  Carbon metabolism
esi01212  Fatty acid metabolism
esi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:esi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Exig_1175
   00630 Glyoxylate and dicarboxylate metabolism
    Exig_1175
   00640 Propanoate metabolism
    Exig_1175
   00650 Butanoate metabolism
    Exig_1175
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Exig_1175
   00072 Synthesis and degradation of ketone bodies
    Exig_1175
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Exig_1175
   00310 Lysine degradation
    Exig_1175
   00380 Tryptophan metabolism
    Exig_1175
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Exig_1175
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Exig_1175
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Exig_1175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:esi04147]
    Exig_1175
Enzymes [BR:esi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Exig_1175
Exosome [BR:esi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Exig_1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACB60654
UniProt: B1YEF2
Position
1217870..1219060
Genome map
AA seq 396 aa AA seqDB search
MSEQVVIVSATRTAIGSFNGSLKDVPATKLGATVIEAALAQANVAPALVEEVIMGNVLQA
GLGQNPARQASLLAGLPESVPAMTINKVCGSGLKAIHLAFQAIKSGEAEIIVAGGMENMS
QAPYVLSGARTGLRMGDQPLVDTIIKDGLECAFNDYHMGITAENLAEQYTISREAQDQFA
ATSQQKASQAIEADRFQAEITPVEIPQRKGDPVVFAEDEFPRAGTTAESLARLRPAFKKD
GTVTAGNASGINDGAAAVVVMSARKAKELGLTTLVEIVANGTSGVDPSIMGIGPVKAVSQ
ALHKAGLELDAIDVIEANEAFAAQSLAVDAELRFDPAKLNRNGGAIALGHPIGASGTRIM
VTLIHEMLRTGESHGLATLCIGGGQGIATIVKKYEE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaagtggtaatcgtcagtgcgacacgtacggcaatcggcagttttaacggc
agtttaaaggatgttccggcaacaaaacttggcgcaacggtcatcgaagcggcactcgca
caggcgaatgtcgcaccagcgctcgtcgaggaagtcatcatgggcaacgtcctgcaggcg
ggactcggacaaaatccggcacggcaggccagtctcctcgccggtctcccggaatcggtc
ccggcgatgacgatcaataaagtctgtggttccggcttaaaggcgattcacctcgcgttt
caagcaatcaagtccggcgaggcggaaatcatcgtcgccggcgggatggaaaacatgagt
caggcaccgtacgtgttaagcggagcccggaccggcttacggatgggcgaccagccgctt
gtcgatacgatcatcaaggacggtctggagtgcgcctttaacgactaccatatgggcatc
acagcggaaaacttagccgagcaatatacgatttcccgggaggcgcaagaccagtttgcg
gcgaccagtcaacaaaaagcaagtcaagccatcgaagcggatcgtttccaagcggaaatc
acaccggttgaaattccacagcgcaaaggtgatccggttgtcttcgccgaagatgagttc
ccgcgtgccggaacgacagcggaatcactcgcacgtttgcgtccggctttcaagaaagac
ggtacggtcacagccggcaatgcatccggcatcaatgacggagcggcagcagtcgtcgtc
atgtcggcccgaaaggcaaaagaacttgggctgaccacgctcgtcgagatcgttgcgaac
ggtacgtccggtgtcgatccgagcatcatggggatcggtcccgtcaaagcggtcagccag
gcgttgcataaagccggtcttgaactggacgccatcgacgtcatcgaggcgaacgaagcg
tttgcggcgcaatcacttgccgtggatgcggaactccggtttgatccggcgaagctaaac
cgtaacggcggagcaattgccctcggtcacccgatcggcgcgagcggaacacggatcatg
gttaccctgattcatgagatgttgcggaccggcgaaagccatggtctggcgacactctgc
atcggcggcggtcaaggaattgcgacgatcgtcaagaagtacgaagagtaa

DBGET integrated database retrieval system