KEGG   Exiguobacterium sibiricum: Exig_2395Help
Entry
Exig_2395         CDS       T00687                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00010  Glycolysis / Gluconeogenesis
esi00051  Fructose and mannose metabolism
esi00562  Inositol phosphate metabolism
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
esi01200  Carbon metabolism
esi01230  Biosynthesis of amino acids
Module
esi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
esi_M00002  Glycolysis, core module involving three-carbon compounds
esi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_2395
   00051 Fructose and mannose metabolism
    Exig_2395
   00562 Inositol phosphate metabolism
    Exig_2395
Enzymes [BR:esi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Exig_2395
Exosome [BR:esi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Exig_2395
  Exosomal proteins of bladder cancer cells
   Exig_2395
  Exosomal proteins of melanoma cells
   Exig_2395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACB61845
UniProt: B1YLE0
Position
complement(2355698..2356450)
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMNLTLKDAVAFAEEVKGTVPASSKVDAAVCAPSVFLAHLTEATAGTDLK
IGAQNMYDQESGAFTGEISPVMLKELGVTYVVLGHSERREYFGETDAFINSKTKKAFEHG
LVPIVCVGETLEEREGGKFESVIREQTTNSLKGLTVDQVKNLVVAYEPVWAIGTGKSATE
QDAQDSCKFVRDVIAAEFGTEAAEAVRIQYGGSVKPDNIKEYMAQPDIDGALVGGASLET
GSFLKLLEAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaatcttaccctcaaggatgctgtg
gcattcgctgaggaagtcaaaggaactgtacccgcttcttcgaaagtcgacgcggctgtc
tgtgcaccgtctgtattccttgcacacttgacagaagcgacagctggaacggacctgaaa
atcggcgctcaaaacatgtacgaccaagagagcggcgcattcacaggtgaaatcagccca
gtgatgctcaaagaacttggcgtaacatacgtcgtcctcggtcactcagaacgtcgtgag
tactttggagaaactgatgcattcatcaacagcaaaacgaaaaaagcattcgagcatggt
ctcgtgccaatcgtttgtgtcggtgaaacactcgaagaacgcgaaggcggaaaattcgaa
tcagtgatccgtgaacaaacaacgaacagcttaaaaggtttgacagtcgatcaagtcaaa
aaccttgttgttgcatatgagcctgtctgggcaatcggaacaggaaaatcagcaacagaa
caagacgcacaagattcttgtaaattcgttcgcgatgtcatcgcagctgaattcggtacg
gaagctgcagaagcagtccgcatccagtacggcggtagtgtcaaaccggacaacatcaaa
gaatatatggctcagcctgacatcgacggtgctttagttggtggcgcaagtcttgagaca
ggatcgttcctcaaactcttggaggcgatttaa

DBGET integrated database retrieval system