KEGG   Exiguobacterium sibiricum: Exig_2728Help
Entry
Exig_2728         CDS       T00687                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00010  Glycolysis / Gluconeogenesis
esi00030  Pentose phosphate pathway
esi00051  Fructose and mannose metabolism
esi00680  Methane metabolism
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
esi01200  Carbon metabolism
Module
esi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_2728
   00030 Pentose phosphate pathway
    Exig_2728
   00051 Fructose and mannose metabolism
    Exig_2728
  09102 Energy metabolism
   00680 Methane metabolism
    Exig_2728
Enzymes [BR:esi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Exig_2728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ACB62176
UniProt: B1YEK8
Position
complement(2714664..2715611)
Genome map
AA seq 315 aa AA seqDB search
MELVRVTEAAALASARWMGKGLKNEADDAATSAMRDVFDTIPMKGTVVIGEGEMDEAPML
YIGEKLGNGYGPRLDVAVDPLEGTNIVAKGTWGALAVLAVADAGDLLHAPDMYMDKIAVG
PEAAGHISLDATIEENIAAVAKAKNKEIEDVVVSILDRERHEEIIQRIRATGARIRLIGD
GDVAAAINTAFPHTGIDILLGSGGAPEGVLAAVALKCLGGELQGRLLPADEAEVARCKKM
GIEDPSKILMMDDLVTGDDCIFAATGVTDSELMKGVQFTAQGGQTHSVVMRAKSGTVRFV
EGIHSFKKKPKLVIK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgtacgcgtaacagaggcagcagcactggcttcggcacgctggatggggaag
ggcttgaaaaacgaggcggatgatgcagcaaccagcgccatgcgtgatgtatttgatacg
atcccgatgaaaggaacagtcgtcatcggcgaaggggaaatggatgaggcaccgatgctg
tatatcggtgagaaactcggaaatggatacggaccgcgtcttgatgtcgcagttgatccg
cttgaggggacgaacatcgtcgccaaaggaacatggggtgcactcgcagttcttgcagtc
gcagatgccggtgatttgttacacgcaccggatatgtacatggataaaattgcggtcgga
ccggaagcagcgggacatatcagcttagatgcgacaatcgaagaaaacatcgctgcagtc
gcaaaagcgaaaaacaaagaaatcgaagacgtcgtcgtctcgattcttgaccgggaacgc
catgaagaaatcattcaacgtattcgcgcaacaggggcccggattcgtttgattggtgac
ggagatgtcgcggcagccatcaatacagctttcccgcacaccgggattgatattctgctc
ggttcaggcggggcgccggaaggtgttcttgcagccgttgccttaaaatgtctcggcgga
gaacttcaaggccgtctcttgccggcggatgaagcagaagtcgcacgatgcaagaagatg
ggcatcgaagatccgtcgaaaatccttatgatggatgatcttgtcacgggagatgactgc
atcttcgcagcaaccggtgtcacagacagcgagttgatgaaaggtgttcagttcacggca
caaggcggtcaaacgcactcggtcgtcatgcgggcgaagtcgggaacggttcgtttcgtt
gaaggtattcactcgttcaagaaaaaaccgaagcttgtgattaagtaa

DBGET integrated database retrieval system