KEGG   Ensifer sojae: SJ05684_b46050Help
Entry
SJ05684_b46050    CDS       T05052                                 

Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
esj  Ensifer sojae
Pathway
esj00270  Cysteine and methionine metabolism
esj00480  Glutathione metabolism
esj01100  Metabolic pathways
Module
esj_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SJ05684_b46050
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SJ05684_b46050
Enzymes [BR:esj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     SJ05684_b46050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ASY65587
UniProt: A0A249PIL8
Position
pSJ05684b:complement(502762..503808)
Genome map
AA seq 348 aa AA seqDB search
MRIAFFVNSIEGEAPYYTTTWLALAALARGHEVCYVTPGDFVLRPDDSMLIRATTLDGAK
PKKPETLLGALKSKQAKISTIELGEVDVLFLRNDPSEDADSRPWAVYVGTNFGRLAAARG
IIVLNDPEGLALAQNKLYFQGFPELVRPTTLISRSIEEIRAFIDSHSRGVVLKPLQGSGG
KNVFKIGSKDEVNLNQIFEVASGGGYLIAQDFLPDAVAGDIRLFLMNGRPLERDGVYAAF
RRIPAKGDVRSNIHASGRPEAATITPEVLAIAEKLRPKLVEDGMFLVGLDIVGDKVLEVN
VFTPGGFPEIAAIVGVDFSDEVITALENKLHLQELYRGRVPNRTLATL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgcctttttcgtcaattccatcgaaggcgaggcgccttactatactacgaca
tggctggcgctggccgcgctcgcgcgcggccacgaggtctgctacgtcacgccgggagat
ttcgtactgcgccccgacgacagcatgctgatccgcgcgacgactttggacggcgcgaag
ccgaagaagcccgagacgttgcttggtgccctgaagagcaagcaggcgaaaatcagcacg
atcgagttgggcgaggtcgatgtgctttttctgcgaaacgacccctccgaagatgcagac
agccgcccctgggcggtttatgtcggcacgaactttggacggctggcggctgcgcgcggc
ataatcgtcctcaatgaccccgaaggcttggcgcttgcgcagaacaagctctatttccag
ggctttcctgagctcgtacggccgacgacgctgatctccagaagtatcgaagaaatccgg
gcgttcatcgacagccattcgcgcggcgtcgtactgaagcccctgcaaggctccggcggc
aagaacgtcttcaagatcggatccaaggacgaagtcaacctcaaccagatcttcgaggtc
gccagcggtggcggttatctgatagcacaggactttctgccggatgcggtcgcaggagac
atccgcctcttcctcatgaatggacggccactcgagcgcgacggcgtgtacgccgccttt
cggcgcatcccggcaaagggcgacgttcgctcgaatatccacgccagcgggaggcccgaa
gccgccaccattacaccggaggttctcgcaatcgccgaaaagcttcgtcccaagctcgta
gaagacggcatgttcctggtcggtctcgacatcgtcggcgacaaggtgctggaggtcaac
gtcttcacacccggtggattccccgagattgcggctatcgttggcgtggacttcagcgac
gaggtcattaccgcgctggagaacaagcttcacctacaggaactctatcgcggcagggtg
ccaaaccgtaccctggcgactctttga

DBGET integrated database retrieval system