KEGG   Ensifer sojae: SJ05684_b58850Help
Entry
SJ05684_b58850    CDS       T05052                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
esj  Ensifer sojae
Pathway
esj00630  Glyoxylate and dicarboxylate metabolism
esj01100  Metabolic pathways
esj01110  Biosynthesis of secondary metabolites
esj01120  Microbial metabolism in diverse environments
esj01130  Biosynthesis of antibiotics
esj01200  Carbon metabolism
Module
esj_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SJ05684_b58850
Enzymes [BR:esj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SJ05684_b58850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ASY66867
UniProt: A0A249PM90
Position
pSJ05684b:1863487..1863876
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEHTDDPHPRNIYWEMWGNPMFDLKD
AKGVMMELEDCRKAYPHDYIRLNAFDSSRGFETVTMSFIVNRPDNEPKLRMTRTESRGRS
QHYAWETRR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccaaggatgcttctcgttcctgccggacctgacggatgagcagataacg
gcacaggtggaatattgcctcggcaagggatgggcgatcggcgtcgaacataccgacgac
ccgcacccccgcaacatctactgggaaatgtggggcaatccgatgttcgacctgaaggac
gccaagggcgtcatgatggagctggaggattgccgcaaggcttatccgcacgactacatc
cgcctcaatgcgttcgattccagccgcggcttcgagaccgtgacgatgtccttcatcgtc
aatcggcccgataacgaaccgaaactgcggatgacccggacggaaagccgtggtcgcagc
cagcactatgcctgggaaacgcggcgatag

DBGET integrated database retrieval system