KEGG   Ensifer sojae: SJ05684_c01280Help
Entry
SJ05684_c01280    CDS       T05052                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
esj  Ensifer sojae
Brite
KEGG Orthology (KO) [BR:esj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SJ05684_c01280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ASY61599
UniProt: A0A249P8L1
Position
complement(130520..130912)
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIVISNHSDIAVRLMTRYWHITDENGQ
VDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSMESEDGETFNVAIPAFSL
DTPGQVRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgcactcactcgcgacatagaagtcacggtagagccgtactatctggaagag
cagtctgaccccgacgacagccgttacgtctgggggtaccgcatcgtcatatcgaaccat
tccgacatcgcggttcgactgatgacccgctattggcatatcaccgacgagaacggtcag
gtggacgaggtcagcggccccggcgtgatcggcgaacagccgctgctgaatccgggcgac
acttacgaatattcttccggctgcccgctggacacaccgtccggtgtcatgttcggccac
tacagtatggagagtgaggacggggagaccttcaacgtcgcgatcccggccttttcgctg
gatacgcccgggcaagtgcggacactgaactga

DBGET integrated database retrieval system