KEGG   Ensifer sojae: SJ05684_c09770Help
Entry
SJ05684_c09770    CDS       T05052                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
esj  Ensifer sojae
Pathway
esj00970  Aminoacyl-tRNA biosynthesis
esj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SJ05684_c09770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:esj03029]
    SJ05684_c09770
Enzymes [BR:esj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SJ05684_c09770
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SJ05684_c09770
Mitochondrial biogenesis [BR:esj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SJ05684_c09770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ASY62436
UniProt: A0A249P997
Position
967012..968493
Genome map
AA seq 493 aa AA seqDB search
MTDLTSLTIAEARAKLTAKEITAVELTDAYIAAIEAANETINAYVDVTQDKAREMARASD
ARIGAGKAGPLEGIPLGIKDLFATEGVHTQACSHILDGFKPRYESTVTQNLWNDGAVMLG
KLNMDEFAMGSSNESSYYGPVKNPWRAKGSNLDLVPGGSSGGSAAAVAAQLCAGATATDT
GGSIRQPAAFTGTVGIKPTYGRCSRFGIVAFASSLDQAGPIARDVRDAAILLRSMASIDP
KDTTSVDLPVPDYEASIGQSIKGMKIGIPKEYRVEGMPEEIEALWQQGIAWLKDAGAEII
DITLPHTQYALPAYYIVAPAEASSNLARYDGVRYGLRVDGKDIVDMYEKTRAAGFGREVK
RRIMIGTYVLSAGYYDAYYLRAQKVRTLIKRDFEIAFQAGVDAILTPATPSSAFGIADED
LAADPVKMYLNDIFTVTVNMAGLPGIAVPGGLDHKGLPLGLQLIGKPFEEETLFKTAHVI
EQAAGRFTPAKWW
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcacgagcctcacgattgccgaagcacgcgcgaaactcaccgccaaggaa
attactgcggttgaactgacggatgcctacatcgccgcgatcgaggcagccaacgaaacc
atcaatgcctatgtcgacgtgacgcaggacaaggcgcgcgagatggccagggcctccgat
gcccgtatcggcgcagggaaggccgggccgcttgagggcattccgcttggcatcaaggat
ctcttcgcgaccgagggcgtccacacccaggcctgcagccacattctcgacggcttcaag
ccgcgctatgaatcgaccgtcacccagaacctctggaacgacggcgccgtcatgctcggc
aagctcaacatggacgagttcgccatgggctcgtcgaacgagagctcctattacggcccg
gtcaagaacccgtggcgcgccaagggctccaacctcgatctcgtgcccggcgggtcctcc
ggcggctcggcagccgcggtcgcggcgcagctctgcgccggcgcgacggcaaccgatacg
ggcggttccatccgccagcctgccgccttcacgggcaccgtcggcatcaagccgacctat
ggccgctgttcgcgcttcggcatcgttgccttcgcctcgtcgctcgaccaggccgggccc
atcgcgcgcgacgtgcgcgacgcggcgatcctcctgaggtcgatggcaagcatcgatccc
aaggacacgacctcggtcgacctgccggtacccgattacgaggcttcgatcggccagtcg
ataaagggcatgaagatcggcattccgaaggaataccgggtcgagggcatgccggaggaa
atcgaggcgctctggcagcagggtatcgcctggctgaaggacgccggcgccgagatcatc
gacattacgctgccgcacacgcagtatgcgctgccggcctattacatcgtcgcgccggcc
gaggcttcctccaacctcgcccgctatgacggcgtgcgctacgggctgcgcgtcgacggc
aaggacatcgtcgacatgtatgagaagacgcgcgccgccggcttcggccgcgaagtcaag
cgccgcatcatgatcggcacctatgtgctttcggccggctattacgacgcctattacctg
cgcgcccagaaggtccgcacgctgatcaagcgcgacttcgagatcgccttccaggcaggc
gtcgatgctatcctgacccctgccacgccgtcctccgccttcggtatcgccgacgaggat
ctcgcagccgatccggtcaagatgtacctgaacgacattttcacggtgacggtcaacatg
gccggactgcccggcatcgcggttcccggcgggctcgaccacaagggactgccccttggt
cttcaactgatcggcaagcctttcgaggaagaaacgctcttcaagacagcccacgtcatc
gagcaggccgccggtcgtttcacccccgccaagtggtggtaa

DBGET integrated database retrieval system