KEGG   Ensifer sojae: SJ05684_c29340Help
Entry
SJ05684_c29340    CDS       T05052                                 

Definition
(GenBank) Cobalt-precorrin-6y C5-methyltransferase
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
esj  Ensifer sojae
Pathway
esj00860  Porphyrin and chlorophyll metabolism
esj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SJ05684_c29340
Enzymes [BR:esj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     SJ05684_c29340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase PCMT Cons_hypoth95 Methyltransf_4 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: ASY64364
UniProt: A0A249PFA8
Position
complement(2874731..2875987)
Genome map
AA seq 418 aa AA seqDB search
MRGLPVADMSNSVSAIAAPWLTIIGIGEDGVAGLGDEAKQLVATAPVVFGGVRHLELAAP
LIRGEGQVWQSPFERSIEAIVARRGSPVVVLGSGDPFLYGVGATLARRIDPSEMRTIPAP
SAFSLAASRLGWALQDVAAVSLHGRPLDLVRPHLQPEGRVLALTSDANGPRALAELLTES
GFGRSRITVLEALGGERERISRQVAADFALEEIHSLNVCAIEVIGEAHARVLPLACGLDD
ALFEHDGQITKREMRALTLSALAPRRGELLWDIGAGSGSIAIEWMLSDPAMRAIAIEASP
ERAARIGRNAASFGVPGLVVVEGQAPDALRGLPEPHVIFIGGGGSEPGVMDAAIAELRSG
GRLVANAVTTEMEAVLLAHHARLGGSLIRIDIARASPVGTMTGWRPAMPVTHWSWTKA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggtctgcccgtggctgacatgtcgaacagcgtctcggccatagccgctccctgg
ctcaccatcatcggtatcggcgaggacggtgtagccggtctcggcgacgaggccaagcag
ctcgttgcgacggcaccggtcgttttcggcggtgtgcgccatctggagcttgcggcaccg
ctgatcagaggcgaaggccaggtctggcaaagccctttcgaaagatcgatcgaggcgatc
gtggcgcggcgcggcagccctgtcgtcgtgcttggctcgggcgacccgttcctctacggc
gtcggcgcgacgcttgcccgtcgcatcgacccgagcgaaatgcgcacgattccggcgccc
tccgcattcagcctggccgcctcacggctcggatgggccttgcaggacgttgcggccgtc
tcactacacggccgtccgctcgatctcgttcggccgcatctgcagccggagggccgggtg
ctggcgctgacatcggacgcaaatggcccgagggcgctcgccgaactcctcaccgaaagc
ggattcggtcggtcccggattaccgtgctcgaagcgctgggaggagagcgcgagcggatt
tcgcggcaggttgccgcagatttcgcgctcgaggaaatccattccctaaacgtctgcgcc
atcgaggtgattggcgaggcgcacgcgcgcgtgctgccgctcgcctgcggcctcgatgac
gccctgttcgaacacgacggccagatcaccaagcgcgagatgcgggcgctgacgctttcg
gcgctcgcaccgcgcaggggcgagcttctctgggatatcggcgccggttccggctcgatc
gccatcgagtggatgctgagcgatccggctatgcgggcgatcgccatcgaggcttcgccc
gagagggccgcgcggatcggccgcaacgccgcaagcttcggtgtaccgggccttgtcgtt
gtcgagggccaggcgccggatgcgctgcgcggccttccggagcctcatgtgatcttcatc
ggcggtggcggcagcgaaccgggggtgatggatgcggcgatcgctgagcttcggagcggc
ggcaggctcgtcgccaatgcggtgacgacggaaatggaagcggtgcttcttgcgcaccac
gcacggcttggcggttcgctgatccgcatcgatatcgcacgggcttcgccggtcggtacc
atgaccgggtggcggccggcgatgccggtcacgcattggtcgtggaccaaggcctga

DBGET integrated database retrieval system