KEGG   Ensifer sojae: SJ05684_c29520Help
Entry
SJ05684_c29520    CDS       T05052                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
esj  Ensifer sojae
Pathway
esj00071  Fatty acid degradation
esj00072  Synthesis and degradation of ketone bodies
esj00280  Valine, leucine and isoleucine degradation
esj00310  Lysine degradation
esj00362  Benzoate degradation
esj00380  Tryptophan metabolism
esj00620  Pyruvate metabolism
esj00630  Glyoxylate and dicarboxylate metabolism
esj00640  Propanoate metabolism
esj00650  Butanoate metabolism
esj00900  Terpenoid backbone biosynthesis
esj01100  Metabolic pathways
esj01110  Biosynthesis of secondary metabolites
esj01120  Microbial metabolism in diverse environments
esj01130  Biosynthesis of antibiotics
esj01200  Carbon metabolism
esj01212  Fatty acid metabolism
esj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SJ05684_c29520
   00630 Glyoxylate and dicarboxylate metabolism
    SJ05684_c29520
   00640 Propanoate metabolism
    SJ05684_c29520
   00650 Butanoate metabolism
    SJ05684_c29520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SJ05684_c29520
   00072 Synthesis and degradation of ketone bodies
    SJ05684_c29520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SJ05684_c29520
   00310 Lysine degradation
    SJ05684_c29520
   00380 Tryptophan metabolism
    SJ05684_c29520
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SJ05684_c29520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SJ05684_c29520
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SJ05684_c29520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:esj04147]
    SJ05684_c29520
Enzymes [BR:esj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SJ05684_c29520
Exosome [BR:esj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SJ05684_c29520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASY64382
UniProt: A0A249PF54
Position
complement(2893004..2894185)
Genome map
AA seq 393 aa AA seqDB search
MSNRDPVVIVSAARTPMGAFQGGLKDMTAPELGATALKAALDRASLDAVDEVLMGNVLPA
GIGQNPARQAALGAGLGQDTPSTTVSKVCGSGMKALMLGHDALLSGSASVVAVGGMESMT
NSPYLLPKARGGFRLGHGEIKDHMFLDGLEDAYSGRLMGTYAEDTAQHYQFSRAEQDAFA
LRSLDRAVKATEDRSFVDEMVAIVDGGKRKSANLDRDEQPAKADPAKIPRLKPAFRDGGS
VTAANSSSISDGAAALILMRASEAERRGLTQLAIVAGHAGHAQEPAWFTTAPIGAIEKLF
DKLGWEKGSVGLYEINEAFAVVAMAAIRDLGLSDDIVNIHGGACALGHPIGASGARIVVT
LLNAMRKNGVKRGIASLCIGGGEATAIGLELVE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgcgatccggtggttatcgtctcggcggcccgcacgccgatgggcgcattc
cagggcgggctcaaggatatgacggcgccggaacttggggccactgcgctgaaggcggcg
ctcgatcgcgcgagcctcgatgccgtcgacgaggtgctgatgggcaatgtgttgcccgcc
ggcatcggacagaatccggcccggcaggcggcactaggcgcgggccttgggcaggatacg
ccctcgacgaccgtttccaaggtttgcggttcgggcatgaaggcgctgatgctcggccac
gacgcgcttctctccggcagcgcttcggtcgtcgcggtcggcggcatggagtcgatgacc
aactccccctatctcctgccgaaggcgcggggcggcttccggctcggccatggcgagatc
aaggaccacatgtttttggacgggcttgaggacgcctattccgggcggctgatgggcacc
tacgccgaggacacggcccaacattaccagttctcccgggcagagcaggacgccttcgcg
ctccgctcgctcgaccgggccgtaaaggcgacggaagacaggtcctttgtcgacgaaatg
gtggcgatagtcgatggcggcaaacgcaagagcgccaatctcgatcgcgacgagcagccg
gcgaaggccgatccggcgaagataccgaggctcaaaccagccttccgcgacggcggcagt
gtcacggccgccaactcctcctcgatatccgatggtgcggcggcgctcatcctgatgcgg
gcgagcgaggcggagaggcgcgggctgacccagcttgcgattgtcgccggccatgccggc
cacgcgcaggagcctgcctggttcaccacggcgccgatcggcgccatcgagaagctgttc
gacaagctcggctgggagaaggggagcgtcggtctctacgaaatcaacgaggcctttgcc
gtcgtcgccatggcggcgatccgcgacctcggcctctccgacgacatcgtcaacatccat
ggcggcgcctgcgcgctcggccacccgatcggcgcctccggcgcgcgcatcgtcgtcacg
cttcttaacgcaatgcggaaaaacggcgtcaaacgcggcatcgcctccctctgcatcggt
ggcggcgaggcgacggcgatagggctggagctggtggagtag

DBGET integrated database retrieval system