KEGG   Ensifer sojae: SJ05684_c31330Help
Entry
SJ05684_c31330    CDS       T05052                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
esj  Ensifer sojae
Pathway
esj00020  Citrate cycle (TCA cycle)
esj00640  Propanoate metabolism
esj00660  C5-Branched dibasic acid metabolism
esj01100  Metabolic pathways
esj01110  Biosynthesis of secondary metabolites
esj01120  Microbial metabolism in diverse environments
esj01130  Biosynthesis of antibiotics
esj01200  Carbon metabolism
Module
esj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SJ05684_c31330
   00640 Propanoate metabolism
    SJ05684_c31330
   00660 C5-Branched dibasic acid metabolism
    SJ05684_c31330
Enzymes [BR:esj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SJ05684_c31330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ASY64557
UniProt: A0A249PFR6
Position
complement(3085600..3086502)
Genome map
AA seq 300 aa AA seqDB search
MSILINKDTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGIHPKKGGETWTGSKGEELPIF
ATVAEGREVTGANASVIYVPPAGAAAAIIEAIDAEIPLIVCITEGIPVADMVKVKARLEK
SSSRLIGPNCPGVLTPDECKIGIMPGNIFRKGSVGVLSRSGTLTYEAVFQTSNEGLGQTT
AVGIGGDPVKGTEFIDVLEMFLADDETKSIIMIGEIGGSAEEDAAQFLKDEAKRGRKKPM
VGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGIRVSPSPARLGKTLVEVLKG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcctgatcaacaaagacaccaaggttctcgtccagggcctgaccggcaagacc
ggcaccttccataccgagcaggcgctcgcctatcacggaacccagatggtcggtggcatc
catccgaagaagggcggcgagacctggaccggctccaagggcgaagagctcccgatcttc
gcgacggtcgccgaagggcgcgaagtcaccggtgcgaacgcatccgtgatctatgtcccg
ccggcgggtgccgctgcggcgatcatcgaggcgatcgatgcggagatcccgctgatcgtc
tgcatcactgagggcatcccggtcgccgacatggtcaaggtcaaggctcggctcgagaag
tcatcctcgcgcctcatcggcccgaactgcccgggcgttctgacacccgacgagtgcaag
atcggcattatgcccggcaacatcttccgcaagggttcggtcggcgtgctttcgcgctcc
ggcacgctcacctacgaggctgtgttccagacgagcaatgagggcctcggccagacgacg
gccgtcggcatcggcggtgatccggtcaagggcaccgagttcatcgacgtgctcgagatg
ttccttgccgacgacgagacgaagtcgatcatcatgatcggcgaaatcggcggctcggcg
gaagaggatgcggcgcagttcctgaaagacgaggccaagcgcggccgcaagaagccgatg
gtcggtttcatcgccggccgcaccgcacctcccggccgtaccatgggccatgccggcgcc
gtcatctccggcggcaagggcggggcggaagacaagatcgcggcgatggaatcggcgggc
atccgcgtttcgccgtcgcccgcgcgcctcggcaagacgctcgtcgaggtcctgaagggc
tga

DBGET integrated database retrieval system