KEGG   Ensifer sojae: SJ05684_c34300Help
Entry
SJ05684_c34300    CDS       T05052                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
esj  Ensifer sojae
Pathway
esj00620  Pyruvate metabolism
esj00630  Glyoxylate and dicarboxylate metabolism
esj01100  Metabolic pathways
esj01110  Biosynthesis of secondary metabolites
esj01120  Microbial metabolism in diverse environments
esj01200  Carbon metabolism
Module
esj_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SJ05684_c34300
   00630 Glyoxylate and dicarboxylate metabolism
    SJ05684_c34300
Enzymes [BR:esj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SJ05684_c34300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ASY64852
UniProt: A0A249PGK5
Position
3399366..3401537
Genome map
AA seq 723 aa AA seqDB search
MDRVEKFGLKIDAGLHRFLVEEAMPGTGIESEHFFSALSALIHDLVPKNRALLARRDDLQ
AQLDAWYREHGAPVDVDGYEAFLRKIGYLLPEGPDFSVSTANVDPEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAISEDDGAERGKSYNPVRGERVIAWVRDFLDVSVPL
AEGRWSEVSGLAIEGAALAVTLANGAKTALRDPAQLAGYVGAADAPAEVVLSRNNLHVAL
ILDEKTAIGKADPAQISDVVVESAITAIMDCEDSVAAVDAEDKIVVYRNWLGLMKGDLEE
EVTKGGQTFTRKLNPDRVYTRPDGSALTLPGRSLMLVRNVGHLMTNPAILDRDGGEVPEG
LMDAMVTALIALHDIGPNGRRANSRAGSMYVVKPKMHGPDEVAFACDIFARVEAALGLSA
NTMKMGIMDEERRTTVNLKECIRAARGRIVFINTGFLDRTGDEIHSSMEAGPMIRKGDMK
QAAWIAAYEDWNVDIGLLCGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVDVAEVQASLKSRPRARLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINDVGLMEDRATLRISSQHMANWLHHGIVTEAQIVETMRR
MAAIVDRQNAADPNYQPMAGRFDESIAFQAALDLVLKGREQPNGYTEPVLHRRRLEQKAK
QGA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcgttgagaaatttggcttgaagatcgatgccggactgcaccgctttctggtc
gaggaggcgatgccggggaccggtatcgagtccgagcacttcttttcggccctgtcggct
ctcatacacgatctcgtgccgaagaaccgcgcgctgctcgcccggcgcgatgacctgcag
gctcagctcgatgcctggtatcgcgagcacggcgcccccgtcgacgtggatggttatgag
gccttcctcaggaagatcggctatctcctgcccgaaggaccggatttctccgtctcgacc
gccaatgtcgatccggagatcgcgacgatcgccgggccgcagctcgtcgtgccggtgatg
aacgcccgctacgccctgaacgccgccaacgcccgctggggctccctctatgatgccctc
tacggaaccgatgcgatttccgaggatgacggcgccgaacgcggcaagagctataacccg
gttcgtggcgaaagggtcatcgcctgggttcgcgattttctcgatgtgagcgttccgctg
gccgagggccgttggagcgaggtaagcgggcttgcgatcgagggcgcggcgctggcggtc
acgctggcgaacggcgccaaaactgcccttcgggatccggctcaactcgccggctatgtc
ggtgcagcggatgctccggccgaggtcgtgctctcccgcaacaatctgcacgtcgccctc
atcctcgatgagaagacggccatcggcaaggccgatccggcgcagatatcggatgtcgtc
gtcgaatcggcgattaccgcgatcatggattgcgaggattccgtcgccgccgtcgatgcc
gaggacaagatcgtcgtctaccgcaactggctcggtctgatgaagggcgatttggaggag
gaggtcaccaagggaggccagaccttcacgcgcaagctcaatcccgatcgggtctatacg
aggcccgacggttcagcgctgacgctgcctggccgatcgctgatgctggtgcgcaatgtc
ggtcacctgatgaccaatccggcgatcctcgaccgcgacggaggcgaggtccccgaaggc
ctcatggacgcgatggtcaccgcactgatcgcgctgcacgacatcggccccaacggccgc
cgggcgaattcgcgcgccggctcgatgtatgtcgtcaagccgaagatgcacggtcccgac
gaagtggcattcgcctgcgatatctttgcgcgtgtcgaggccgcactcggactttcggcc
aatacgatgaagatgggtatcatggacgaggagcggcgcaccaccgtcaacctcaaggaa
tgcatccgcgccgcgcgcggacgcatcgtcttcatcaataccggcttcctcgatcgtacc
ggcgacgaaatccactcctcgatggaagccggtccgatgatccgcaagggcgacatgaag
caggcggcctggattgccgcctacgaagactggaacgtcgacatcggccttctatgcggg
ctttccggccacgcgcagatcggcaagggcatgtgggccatgccggacctgatggcggcg
atgctcgaacagaagatcgcccatccgaaggcgggtgccaacacggcctgggttccctct
ccgacggccgcgacgctgcatgcgacccattaccatcgcgtcgacgttgccgaggtccag
gcgagcctcaagagccggccccgcgccaggctcgcggacatcctctcggtgccggtggcg
gcgcggccgaactggaccgaggaggaaatccagcgcgaactcgacaacaatgcgcagggc
attctcggctatgtcgttcgctgggtcgatcagggcgtcggttgctcgaaggtgccggac
atcaacgatgtcggcctgatggaagaccgcgcgacgctgcgcatctcctcacagcacatg
gcgaattggctgcatcacggcatcgtcaccgaggcgcagatcgtcgagacgatgaggcgg
atggcggcgatcgtcgaccggcagaacgccgccgatccgaactaccagccgatggccggc
cgcttcgacgaatcgatcgccttccaggccgccctcgacctcgtgctcaaggggcgcgaa
cagccgaacggttataccgaaccggtgctccatcgccggcgcctggaacagaaggcgaag
cagggggcgtga

DBGET integrated database retrieval system