KEGG   Escherichia coli O104 H4 2011C-3493: O3K_01065Help
Entry
O3K_01065         CDS       T02257                                 

Gene name
glyQ
Definition
(RefSeq) glycyl-tRNA synthetase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:esl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    O3K_01065 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:esl01007]
    O3K_01065 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:esl03016]
    O3K_01065 (glyQ)
Enzymes [BR:esl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     O3K_01065 (glyQ)
Amino acid related enzymes [BR:esl01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   O3K_01065 (glyQ)
Transfer RNA biogenesis [BR:esl03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    O3K_01065 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-GeneID: 13698880
NCBI-ProteinID: YP_006776947
UniProt: A0A0E0XW34
Position
208549..209460
Genome map
AA seq 303 aa AA seqDB search
MQKFDTRTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPMAAAYVQ
PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN
WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV
YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALENPL
PLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREALGFPMCN
KDK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtttgataccaggaccttccagggcttgatcctgaccttacaggattactgg
gctcgccagggctgcaccattgttcaaccattggacatggaagtcggcgcgggaacctct
cacccaatgacctgtctgcgcgcgctggggccagaaccgatggcggctgcttatgttcag
ccttctcgtcgcccgaccgatggtcgctacggcgaaaaccccaaccgtttacagcactac
tatcagttccaggtggtcattaagccatcgccggacaatattcaggagctgtacctcggt
tctctgaaagagctgggcatggacccgactattcacgacatccgtttcgtggaagataac
tgggaaaacccgactctgggtgcctggggactgggctgggaagtgtggctaaacggcatg
gaagtgacgcagttcacttacttccagcaggttggtggtctggagtgtaaaccggttacc
ggcgagatcacctacggtctggaacgtctggccatgtacattcagggcgtagacagcgtt
tacgacctggtctggagcgacggcccgctgggtaaaaccacctacggcgacgtgttccat
cagaacgaagtggagcagtccacttacaacttcgaatacgcggatgtggacttcctgttc
acctgctttgagcagtacgagaaagaagcgcagcagctgctggcgctggaaaatccgctg
ccgctgccagcctacgagcgtattctgaaagccgcccacagcttcaacctgctggatgcg
cgtaaagccatctccgtcaccgagcgtcagcgctacattctgcgcattcgcaccctgacc
aaagcagtggcagaagcatactacgcttcccgtgaagccctcggcttcccgatgtgcaac
aaagataagtaa

DBGET integrated database retrieval system