KEGG   Escherichia coli O104 H4 2011C-3493: O3K_02840Help
Entry
O3K_02840         CDS       T02257                                 

Definition
(RefSeq) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00520  Amino sugar and nucleotide sugar metabolism
esl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    O3K_02840
Enzymes [BR:esl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     O3K_02840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-GeneID: 13699239
NCBI-ProteinID: YP_006777298
UniProt: A0A0E0XVA6
Structure
PDB: 

Position
579699..580592
Genome map
AA seq 297 aa AA seqDB search
MATNLRGVMAALLTPFDQQQALDKASLRRLVQFNIQQGIDGLYVGGSTGEAFVQSLSERE
QVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRYGFDAVSAVTPFYYPFSFEEHCD
HYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPGVGALKQTSGDLYQMEQIRRE
HPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTECN
KVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEKYLPELKALAQQLMQERG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaatttacgtggcgtaatggctgcactcctgactccttttgaccaacaacaa
gcactggataaagcgagtctgcgtcgcctggttcagttcaatattcagcagggcatcgac
ggtttatacgtgggtggttcgaccggcgaggcctttgtacaaagcctttccgagcgtgaa
caggtactggaaatcgtcgccgaagaggcgaaaggtaagattaaactcatcgcccacgtc
ggttgcgtcagcaccgccgaaagccaacaacttgcggcatcggctaaacgttatggcttc
gatgccgtctccgccgtcacgccgttctactatcctttcagctttgaagaacactgcgat
cactatcgggcaattattgattcggcggatggtttgccgatggtggtgtacaacattcca
gccctgagtggggtaaaactgaccctggatcagatcaacacacttgttacgttgcctggc
gtaggtgcgctgaaacagacctctggcgatctctatcagatggagcagatccgtcgtgaa
catcctgatctggtgctctataacggttacgacgaaatcttcgcctctggtcttctggcg
ggcgctgatggtggtatcggtagtacctacaacatcatgggctggcgttatcaggggatt
gtgaaggcgctgaaagaaggcgatatccagaccgcgcagaagctgcaaaccgaatgtaat
aaagtcattgatttactgatcaaaacgggcgtattccgcggcctgaaaactgtcctgcat
tatatggatgtcgtttctgtgccgctgtgccgcaaaccgtttggtccggtagatgaaaaa
tatctgccagaactgaaggcgctggcccagcagttgatgcaagagcgcgggtga

DBGET integrated database retrieval system