KEGG   Escherichia coli O104 H4 2011C-3493 (EAEC): O3K_04415Help
Entry
O3K_04415         CDS       T02257                                 

Definition
(RefSeq) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
esl  Escherichia coli O104:H4 2011C-3493 (EAEC)
Brite
KEGG Orthology (KO) [BR:esl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:esl02044]
    O3K_04415
Secretion system [BR:esl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3K_04415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-GeneID: 13700558
NCBI-ProteinID: YP_006777610
UniProt: A0A0E0XVZ0
Position
897849..899261
Genome map
AA seq 470 aa AA seqDB search
MQEEEQLVYWYSGLYLQPQHFQSIDLHHGFMLARSRQLSQPHHQGYYECCINDDLLKEDT
VRVEKIKAVLSSGYYIEYPGNCVVQDKCLTNLKGSDHGTVDLWLALKRFNSGHKNVSSVN
DKRGSARWISSDDERNMRNVYHDSQDADITRIKYDIQILTDEEKDNTTDYEYLPLTRIIY
GNNSLCIDDECSFPVMRLSANHKLRNKIAEIYSDIKFYKNRLEKYRYTERTVSDGHLYNF
LILCAINRTLPLLSSFINEDAIHPWLYYMALCQFAGEISTFHNSGLSDTRIVELSYNHYE
QISCFSDLQYYIKLILDDSCRDKIISVEFRKITTDTLICNFDEYGAGSNSDYYIKLTSDT
FRKNKLIALPEIKIAPSEHIDMIIQHALPGIKFTVMDAVTSDLQVRENTIWLKIDKHSEL
WTLAQTQKRVAFYWSCSPDDLLVELVLSQEKYAVSRPKQDNGSFHPAVGR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagaagaacaacttgtttattggtattcagggctctatttacaacctcagcac
tttcagtcaattgacttgcatcatggcttcatgcttgccagaagcaggcagttatcacaa
ccccatcatcaggggtactatgaatgttgtatcaatgatgatcttcttaaggaagatact
gtcagagttgaaaaaataaaggctgttttatcttcagggtattatatcgagtatccgggt
aactgtgtggtacaggataagtgcctgacaaatctcaaaggttcagatcacggtaccgtg
gatttgtggcttgcgcttaagagattcaattccggtcataaaaatgtctccagtgttaat
gataaacgaggctctgccagatggataagttcagatgatgaacgtaacatgcgtaatgtt
tatcatgacagtcaggatgccgatattacaagaataaaatatgatattcagattcttaca
gatgaggaaaaagataatactacagactatgagtatttacccctgacaaggatcatatat
ggaaataattcattatgtattgatgatgagtgttcatttcccgtgatgaggttatctgcg
aatcacaaacttagaaataagatcgcagagatctattcggatattaagttctacaaaaat
agactggagaaatacagatatacagaacgaacagtgtccgatggacatctttataacttt
ttaattctatgtgctattaataggacattaccacttctttcttcattcattaatgaagat
gccattcacccatggttgtattatatggcattatgtcagtttgcaggggaaatatctaca
tttcataactctggactttcagatactaggattgtcgaactatcatacaatcattatgag
cagatctcatgtttcagtgatctgcagtattatattaagttaatactggatgattcatgt
cgagataagattattagtgttgaattcagaaaaataactactgatacattgatctgtaat
ttcgatgagtacggtgccggaagtaattcagattactatattaagttaacctcagatacc
ttcagaaagaataagctgattgcattgccagagattaagattgctccatctgaacatatc
gacatgataattcagcatgctcttccaggaatcaagtttacagtgatggatgccgttaca
tctgatttgcaggtaagagagaatacaatctggttaaagatagataaacattcagaatta
tggacgttagctcagactcaaaaaagagttgcattctattggtcatgtagtcctgatgat
ttacttgtagagttagtattatcgcaggaaaagtatgccgtaagcaggcctaaacaggat
aacggttctttccatccggcggttggcagataa

DBGET integrated database retrieval system