KEGG   Escherichia coli O104 H4 2011C-3493 (EAEC): O3K_05125
Entry
O3K_05125         CDS       T02257                                 

Definition
(RefSeq) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
esl  Escherichia coli O104:H4 2011C-3493 (EAEC)
Pathway
esl00230  Purine metabolism
esl01100  Metabolic pathways
esl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    O3K_05125
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-GeneID: 13700694
NCBI-ProteinID: YP_006777745
UniProt: A0A0E0XWD8
Position
complement(1054843..1055322)
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVQDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttcaggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system