KEGG   Escherichia coli O104 H4 2011C-3493: O3K_07940Help
Entry
O3K_07940         CDS       T02257                                 

Definition
(RefSeq) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00130  Ubiquinone and other terpenoid-quinone biosynthesis
esl00627  Aminobenzoate degradation
esl01100  Metabolic pathways
esl01110  Biosynthesis of secondary metabolites
esl01120  Microbial metabolism in diverse environments
esl01220  Degradation of aromatic compounds
Module
esl_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    O3K_07940
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    O3K_07940
Enzymes [BR:esl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     O3K_07940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 13703049
NCBI-ProteinID: YP_006778295
UniProt: A0A0E0XXX3
Position
1643747..1644316
Genome map
AA seq 189 aa AA seqDB search
MKRLIVGISGASGAIYGVRLLQVLRDVTDIETHLVMSQAARQTLSLETDFSLREVQALAD
VTHDARDIAASISSGSFQTLGMVILPCSIKTLSGIVHSYTDGLLTRAADVVLKERRPLVL
CVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFAITLPE
DLFARWQGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactcattgtaggcatcagcggtgccagcggcgcgatttatggcgtgcgctta
ttacaggttctgcgcgatgtcacagatatcgaaacgcatctggtgatgagccaggcagcg
cgccagaccttatccctcgaaacggatttttctctgcgcgaagtgcaggcattagccgat
gtcacgcacgatgcgcgcgatattgccgccagcatctcttccggttctttccagacgctg
gggatggttattttaccctgttcaatcaaaaccctttccggcattgtccatagctacacc
gatggtttactgacccgtgcggcagatgtggtgctgaaagagcgtcgcccgttggtgctc
tgcgtgcgtgaaacaccattgcacttaggccatctgcgtttaatgactcaggcagcagaa
atcggtgcggtgattatgcctcccgttccggcgttttatcatcgcccacagtcccttgat
gatgtgataaatcagacggttaatcgtgttcttgaccagtttgcgataacccttcctgaa
gatctctttgcccgctggcagggcgcataa

DBGET integrated database retrieval system