KEGG   Escherichia coli O104 H4 2011C-3493 (EAEC): O3K_08395Help
Entry
O3K_08395         CDS       T02257                                 

Definition
(RefSeq) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
esl  Escherichia coli O104:H4 2011C-3493 (EAEC)
Pathway
esl00020  Citrate cycle (TCA cycle)
esl00620  Pyruvate metabolism
esl01100  Metabolic pathways
esl01110  Biosynthesis of secondary metabolites
esl01120  Microbial metabolism in diverse environments
esl01130  Biosynthesis of antibiotics
esl01200  Carbon metabolism
Module
esl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3K_08395
   00620 Pyruvate metabolism
    O3K_08395
Enzymes [BR:esl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     O3K_08395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 K_oxygenase FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 13703138
NCBI-ProteinID: YP_006778384
UniProt: A0A0E0XWM9
Position
1750971..1752617
Genome map
AA seq 548 aa AA seqDB search
MKKVTAMLFSMAVGLNAVSMAAKAKASEEQETDVLLIGGGIMSATLGTYLRELEPEWSMT
MVERLEGVAQESSNGWNNAGTGHSALMELNYTPQNADGSISIEKAVAINEAFQISRQFWA
HQVERGVLRTPRSFINTVPHMSFVWGEDNVNFLRARYAALQQSSLFRGMRYSEDHAQIKE
WAPLVMEGRDPQQKVAATRTEMGTDVNYGEITRQLIASLQKKSNFSLQLSSEVRALKRND
DNTWTVTVADLKNGTAQNIRAKFVFIGAGGAALKLLQESGIPEAKDYAGFPVGGQFLVSE
NPDVVNHHLAKVYGKASVGAPPMSVPHIDTRVLDGKRVVLFGPFATFSTKFLKNGSLWDL
MSSTTTSNVMPMMHVGLDNFDLVKYLVSQVMLSEEDRFEALKEYYPQAKKEDWRLWQAGQ
RVQIIKRDAEKGGVLRLGTEVVSDQQGTIAALLGASPGASTAAPIMLDLLEKVFGDRVSS
PQWQATLKAIVPSYGRKLNGDVAATERELQYTSEVLGLKYDKPQAADSTPKPQLKPQPVQ
KEVADIAL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgactgccatgctcttctcgatggccgtggggcttaatgccgtttcgatg
gcggcaaaagcgaaagcgtccgaggagcaggaaactgatgtactgttgattggcggcggc
attatgagcgccacgttggggacctatttacgcgagctggagcctgaatggtcgatgacc
atggtggagcgcctggagggtgtcgcgcaggagagttcgaacggctggaataacgccgga
accgggcattctgcactgatggaactgaactacaccccgcaaaacgccgatggcagcatc
agtattgaaaaagcagtcgccattaacgaagcatttcagatttcccgccagttctgggcg
caccaggttgagcgcggcgtgctgcgtactccgcgttcatttatcaataccgttccgcat
atgagctttgtctggggcgaggataacgttaatttcctgcgcgcccgttacgccgcgttg
caacaaagctcgctgtttcgcggtatgcgttactctgaagatcacgcgcagatcaaagag
tgggcaccgttagtgatggaagggcgcgatccacaacagaaagtagcggcaacacgcaca
gaaatgggcactgatgtgaactatggcgagatcacccgccagttaattgcttccttacag
aagaaatctaacttctcgctgcaactcagcagcgaagtccgcgccctaaagcgtaatgac
gataacacctggaccgttaccgttgccgatctgaaaaacggcactgcacagaacatccgc
gccaaatttgtctttatcggcgcgggcggtgcggcgctgaagctattacaggaatcgggg
attccggaagcgaaagactacgccggtttcccggtgggcggacagttccttgtttcggaa
aacccggacgtggttaatcaccatctggcgaaggtttacggtaaagcatccgttggcgca
ccaccgatgtcggttccgcatatcgatacccgcgttctggacggtaaacgcgtagtgctg
tttgggccatttgccaccttctcaaccaaattcctcaaaaacggttcattgtgggatctg
atgagttccaccaccacctctaacgtgatgccgatgatgcacgtcgggctggataatttc
gatctggtgaaatatctggtgagtcaggtgatgttgagtgaagaggatcgttttgaagcg
ttgaaagagtactatccgcaggcaaaaaaagaggactggcgtttgtggcaagcggggcag
cgcgtgcagattatcaagcgtgatgccgagaaaggtggcgtactgcgtctgggtactgaa
gtggtcagtgaccagcaagggaccattgccgcgctgctgggggcatcgccaggggcgtca
accgccgcgccgattatgttggatctgctggaaaaagtatttggcgatcgcgtttccagc
ccgcaatggcaggctacgttgaaagcgatcgttccgtcttatggacgcaagctgaacggt
gatgtagcggcaacagaacgcgagttgcagtacaccagcgaagtgctggggctgaaatac
gacaagccgcaggcagcagatagtacgccaaaaccgcagttgaaaccgcaacccgttcaa
aaagaagtggcggatattgcgttgtaa

DBGET integrated database retrieval system