KEGG   Escherichia coli O104 H4 2011C-3493: O3K_11140Help
Entry
O3K_11140         CDS       T02257                                 

Definition
(RefSeq) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00450  Selenocompound metabolism
esl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    O3K_11140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:esl03016]
    O3K_11140
Enzymes [BR:esl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     O3K_11140
Transfer RNA biogenesis [BR:esl03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    O3K_11140
 Prokaryotic Type
    O3K_11140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 13699758
NCBI-ProteinID: YP_006778923
UniProt: A0A0E0XZX0
Structure
PDB: 

Position
2302367..2303410
Genome map
AA seq 347 aa AA seqDB search
MSENSIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIARE
VTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVPTERVKKNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGASFANIEGVKAMTDVTGFGLLGHLSEM
CQGAGVQARVDYDAIPKLPGVEEYIKLGAVPGGTERNFASYGHLMGEMPREVRDLLCDPQ
TSGGLLLAVMPEAENEVKTTAAEFGIELTAIGELVPARGGRAMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaactcgattcgtttgacccaatacagccacggagctggttgcggctgtaaa
atttccccaaaagtgttggaaaccatcctgcacagtgagcaggcgaagtttgttgatccg
aatttgcttgtgggtaatgagacccgcgacgatgcggcggtgtacgatctgggcaatggc
accagcgttatcagtaccaccgacttctttatgccgatcgttgataatcctttcgatttt
ggccgcattgcggcgactaacgccatcagcgatatcttcgcgatggggggcaaaccgatt
atggcgattgcgatcctcggctggccgattaacaaactttccccggaaattgcccgcgaa
gtaaccgaaggtggacgctatgcatgccgtcaggcgggtattgcgctggctggcggtcac
tccatcgatgcgccggagccgatttttggtctggcggtaacggggatcgtaccgaccgag
cgggtgaagaaaaacagtaccgcacaagccggatgcaaactgttcctgacgaaaccgctg
gggatcggcgttcttaccacggctgagaaaaaatcactgttgaaaccagaacatcaggga
ctggcgacggaagtgatgtgccggatgaacatcgcaggtgcgtcctttgccaacatcgaa
ggcgtaaaagcgatgaccgacgttactggttttggtctgctgggccatttgagcgaaatg
tgtcagggcgcaggtgtgcaggcgcgcgttgactatgacgcgatcccaaaattgccgggg
gttgaagagtacattaagttgggcgcagtgcctggcggcaccgaacgtaactttgccagc
tacggtcatctgatgggtgaaatgccgcgtgaagtgcgcgatctgctgtgcgatccgcaa
acttctggcggtttgctgctggcggtcatgccggaagcagaaaatgaggttaaaactaca
gccgccgagtttggcattgaactgacggcgattggcgaactggtgccagcgcgcggcggt
cgtgccatggttgagatccgttaa

DBGET integrated database retrieval system