KEGG   Escherichia coli O104 H4 2011C-3493: O3K_13505Help
Entry
O3K_13505         CDS       T02257                                 

Definition
(RefSeq) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00071  Fatty acid degradation
esl00280  Valine, leucine and isoleucine degradation
esl00281  Geraniol degradation
esl00310  Lysine degradation
esl00360  Phenylalanine metabolism
esl00362  Benzoate degradation
esl00380  Tryptophan metabolism
esl00410  beta-Alanine metabolism
esl00627  Aminobenzoate degradation
esl00640  Propanoate metabolism
esl00650  Butanoate metabolism
esl00903  Limonene and pinene degradation
esl00930  Caprolactam degradation
esl01100  Metabolic pathways
esl01110  Biosynthesis of secondary metabolites
esl01120  Microbial metabolism in diverse environments
esl01130  Biosynthesis of antibiotics
esl01212  Fatty acid metabolism
Module
esl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    O3K_13505
   00650 Butanoate metabolism
    O3K_13505
  Lipid metabolism
   00071 Fatty acid degradation
    O3K_13505
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3K_13505
   00310 Lysine degradation
    O3K_13505
   00360 Phenylalanine metabolism
    O3K_13505
   00380 Tryptophan metabolism
    O3K_13505
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3K_13505
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    O3K_13505
   00281 Geraniol degradation
    O3K_13505
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3K_13505
   00627 Aminobenzoate degradation
    O3K_13505
   00930 Caprolactam degradation
    O3K_13505
Enzymes [BR:esl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     O3K_13505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 13702276
NCBI-ProteinID: YP_006779387
UniProt: A0A0E0Y339
Structure
PDB: 

Position
complement(2774888..2775655)
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIIPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRSPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatacctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctctgctttcttacaaaaacgctcgcctgactttaaaggacgctaa

DBGET integrated database retrieval system