KEGG   Escherichia coli O104 H4 2011C-3493 (EAEC): O3K_16335Help
Entry
O3K_16335         CDS       T02257                                 

Definition
(RefSeq) glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
esl  Escherichia coli O104:H4 2011C-3493 (EAEC)
Pathway
esl00010  Glycolysis / Gluconeogenesis
esl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3K_16335
Enzymes [BR:esl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     O3K_16335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 13701321
NCBI-ProteinID: YP_006779941
UniProt: A0A0E0Y1H0
Structure
PDB: 

Position
complement(3317844..3319085)
Genome map
AA seq 413 aa AA seqDB search
MNKTLIAAAVAGIVLIASNAQAQTVPEGYQLQQVLMMSRHNLRAPLANNGSVLEQSTPNK
WPEWDVPGGQLTTKGGVLEVYMGHYMREWLAQQGMVKSGECPPPDTVYAYANSLQRTVAT
AQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSKLQLTDS
YQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYY
EGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRT
SAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKANRDLMKIE
YVYQSAEQLRNADALTLQAPAQRVTLELSGCPIDANGFCPMDKFDSVLNEAVK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacgctaatcgccgcagctgtggcagggatagttttaatcgcttcaaacgct
caggcacaaaccgtaccggaaggctatcagctacagcaagtgctcatgatgagccgccat
aacttacgtgcgccgctggcgaacaatggcagtgtgctggagcagtcgacgccgaataaa
tggccagaatgggacgtccccggtgggcaactcaccaccaaaggtggcgtgctcgaagtg
tatatgggccattacatgcgtgaatggctggcacagcaggggatggtgaaatcgggggaa
tgcccgccgccggacaccgtttatgcctatgccaatagtctgcaacgtaccgttgcgacc
gcacagttctttattaccggcgcattcccggggtgtgatattcctgtgcatcaccaggaa
aaaatgggcactatggacccaacctttaacccggtgatcaccgatgattccgccgcattc
agtgaacaggcggtggcggcaatggagaaagagctcagcaaactccagcttaccgacagc
taccaactactggaaaaaatcgttaactataaagattcccctgcctgtaaagagaaacaa
cagtgttcgctggtggatggcaaaaatacctttagcgccaagtatcaacaagaaccaggt
gtttccgggccgctgaaagtcggcaactcgctggtagatgcgtttactttgcaatattac
gaaggttttccgatggatcaggtggcctggggagaaatcaaatctgaccagcagtggaag
gtgttgtcgaagcttaaaaacggctaccaggacagcctgtttacctcaccggaagtggcg
cgcaatgttgcgaaaccgctggtcagttatatcgacaaagctctggtcaccgatcgcacc
agcgcaccgaaaattacagtgttggttgggcacgactccaacattgcctctctgttaacg
gcgctggatttcaaaccgtatcagttgcatgaccagaacgaacgcacgccgattggcggc
aaaatcgttttccagcgttggcatgacagcaaagccaatcgcgatttgatgaaaattgaa
tatgtgtatcagagtgcggaacagttacgtaatgccgatgcgttaaccctgcaggcacct
gctcagcgtgtgacgctggaattaagcggttgcccgatagatgccaacggtttctgccca
atggataagtttgatagcgtgttgaatgaggcggtgaaataa

DBGET integrated database retrieval system