KEGG   Escherichia coli O104 H4 2011C-3493: O3K_17650Help
Entry
O3K_17650         CDS       T02257                                 

Definition
(RefSeq) lysozyme, DLP12 prophage
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Brite
Enzymes [BR:esl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     O3K_17650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme
Motif
Other DBs
NCBI-GeneID: 13701748
NCBI-ProteinID: YP_006780204
UniProt: A0A0E0Y1X6
Structure
PDB: 

Position
complement(3607702..3608199)
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIATASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTEAECKALLNKDLATVARQINPYIEVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctaca
gcatcagtgttaatcactggcccaagtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacgggcatacaggaaaagacatc
atgctcggtaaaacgtataccgaagcagagtgcaaagccctcctgaataaagaccttgcc
actgtcgccaggcaaattaacccgtatatcgaagtcgatataccggaaacaacgcgcggc
gctctttactcattcgtttacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctacgtcgctggacatat
gctggcggtaagcaatggaaagggctgatgactcgccgtgagattgagcgtgaagtctgt
ttgtgggggcagcaatga

DBGET integrated database retrieval system