KEGG   Escherichia coli O104 H4 2011C-3493: O3K_18030Help
Entry
O3K_18030         CDS       T02257                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00020  Citrate cycle (TCA cycle)
esl00190  Oxidative phosphorylation
esl00650  Butanoate metabolism
esl01100  Metabolic pathways
esl01110  Biosynthesis of secondary metabolites
esl01120  Microbial metabolism in diverse environments
esl01130  Biosynthesis of antibiotics
esl01200  Carbon metabolism
Module
esl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
esl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3K_18030 (sdhD)
   00650 Butanoate metabolism
    O3K_18030 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    O3K_18030 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 13701912
NCBI-ProteinID: YP_006780280
UniProt: A0A0E0Y3J8
Structure
PDB: 

Position
complement(3675339..3675686)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVVFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcgtttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggcattgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system